Recombinant Human DBC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DBC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human DBC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DBC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DBC1 Protein

  • DBCCR1deleted in bladder cancer protein 1
  • deleted in bladder cancer 1
  • deleted in bladder cancer chromosome region candidate 1
  • FAM5AbA574M5.1 (deleted in bladder cancer chromosome region candidate 1 (IB3089A))
  • Protein FAM5A

Background

DBC1 - deleted in bladder cancer 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22294
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-88862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1555
Species: Hu
Applications: WB
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001620-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DBC1 Partial Recombinant Protein (H00001620-Q01) (0)

There are no publications for DBC1 Partial Recombinant Protein (H00001620-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBC1 Partial Recombinant Protein (H00001620-Q01) (0)

There are no reviews for DBC1 Partial Recombinant Protein (H00001620-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DBC1 Partial Recombinant Protein (H00001620-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DBC1 Products

Bioinformatics Tool for DBC1 Partial Recombinant Protein (H00001620-Q01)

Discover related pathways, diseases and genes to DBC1 Partial Recombinant Protein (H00001620-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DBC1 Partial Recombinant Protein (H00001620-Q01)

Discover more about diseases related to DBC1 Partial Recombinant Protein (H00001620-Q01).
 

Pathways for DBC1 Partial Recombinant Protein (H00001620-Q01)

View related products by pathway.

PTMs for DBC1 Partial Recombinant Protein (H00001620-Q01)

Learn more about PTMs related to DBC1 Partial Recombinant Protein (H00001620-Q01).
 

Research Areas for DBC1 Partial Recombinant Protein (H00001620-Q01)

Find related products by research area.

Blogs on DBC1

There are no specific blogs for DBC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
DBC1 Antibody
NBP1-85305

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DBC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DBC1