Recombinant Human DAZAP2 Protein

Images

 
SDS-Page: Recombinant Human DAZAP2 Protein [H00009802-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human DAZAP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-168 of Human DAZAP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DAZAP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
43.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAZAP2 Protein

  • DAZ associated protein 2
  • deleted in azoospermia associated protein 2
  • Deleted in azoospermia-associated protein 2
  • KIAA0058DAZ-associated protein 2
  • MGC14319
  • MGC766
  • proline-rich transcript in brain
  • proline-rich transcript, brain-expressed protein
  • PRTB

Background

In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region and is deleted in many azoospermic and severely oligospermic men. It is thought that the Y chromosomal DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-90213
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82741
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-60555
Species: Hu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00080331-B01P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB100-2437
Species: Rt
Applications: WB, PEP-ELISA
NBP2-32593
Species: Hu
Applications: ICC/IF, IHC, IHC-P
E2-616
Species: Hu
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-67180
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-19083
Species: Hu
Applications: WB, ICC/IF
NBP2-37897
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
MAB1207
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for DAZAP2 Recombinant Protein (H00009802-P01) (0)

There are no publications for DAZAP2 Recombinant Protein (H00009802-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAZAP2 Recombinant Protein (H00009802-P01) (0)

There are no reviews for DAZAP2 Recombinant Protein (H00009802-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAZAP2 Recombinant Protein (H00009802-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for DAZAP2 Recombinant Protein (H00009802-P01)

Discover related pathways, diseases and genes to DAZAP2 Recombinant Protein (H00009802-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAZAP2 Recombinant Protein (H00009802-P01)

Discover more about diseases related to DAZAP2 Recombinant Protein (H00009802-P01).
 

Pathways for DAZAP2 Recombinant Protein (H00009802-P01)

View related products by pathway.

PTMs for DAZAP2 Recombinant Protein (H00009802-P01)

Learn more about PTMs related to DAZAP2 Recombinant Protein (H00009802-P01).

Blogs on DAZAP2

There are no specific blogs for DAZAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DAZAP2 Antibody (8G5)
H00009802-M06-100ug
UbcH5a/UBE2D1
E2-616-100

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAZAP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAZAP2