Recombinant Human DAB2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DAB2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-98 of Human DAB2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DAB2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAB2 Protein

  • DAB2
  • Differentially-expressed protein 2
  • disabled (Drosophila) homolog 2 (mitogen-responsive phosphoprotein)
  • disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila)
  • Disabled-2
  • DOC2
  • DOC-2DOC2disabled homolog 2
  • FLJ26626
  • mitogen-responsive phosphoprotein

Background

DAB2 - disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30081
Species: Hu, Mu
Applications: WB, IP
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF7904
Species: Hu, Mu
Applications: WB
NBP2-13930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00026119-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
AF1936
Species: Hu
Applications: WB, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for DAB2 Partial Recombinant Protein (H00001601-Q01) (0)

There are no publications for DAB2 Partial Recombinant Protein (H00001601-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAB2 Partial Recombinant Protein (H00001601-Q01) (0)

There are no reviews for DAB2 Partial Recombinant Protein (H00001601-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAB2 Partial Recombinant Protein (H00001601-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAB2 Products

Bioinformatics Tool for DAB2 Partial Recombinant Protein (H00001601-Q01)

Discover related pathways, diseases and genes to DAB2 Partial Recombinant Protein (H00001601-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAB2 Partial Recombinant Protein (H00001601-Q01)

Discover more about diseases related to DAB2 Partial Recombinant Protein (H00001601-Q01).
 

Pathways for DAB2 Partial Recombinant Protein (H00001601-Q01)

View related products by pathway.

PTMs for DAB2 Partial Recombinant Protein (H00001601-Q01)

Learn more about PTMs related to DAB2 Partial Recombinant Protein (H00001601-Q01).

Blogs on DAB2

There are no specific blogs for DAB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAB2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAB2
Entrez