Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (3C1)

Images

 
Western Blot: Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (3C1) [H00025830-M02] - Analysis of SULT4A1 expression in transfected 293T cell line by SULT4A1 monoclonal antibody (M02), clone 3C1. Lane 1: SULT4A1 ...read more
Sandwich ELISA: Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (3C1) [H00025830-M02] - Detection limit for recombinant GST tagged SULT4A1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (3C1) Summary

Immunogen
SULT4A1 (NP_055166.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK
Specificity
SULT4A1 - sulfotransferase family 4A, member 1 (3C1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SULT4A1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against transfected lysate and Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (3C1)

  • Brain sulfotransferase-like protein
  • BRSTL1
  • BR-STL-1
  • Cytosolic Sulfotransferase 4A1
  • EC 2.8.2.-
  • hBR-STL
  • hBR-STL-1MGC40032
  • nervous system cytosolic sulfotransferase
  • Nervous system sulfotransferase
  • NST
  • ST4A1
  • sulfotransferase 4A1
  • sulfotransferase family 4A, member 1
  • sulfotransferase-related protein
  • SULT4A1
  • SULTX3
  • SULTX3DJ388M5.3

Background

This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58314
Species: Hu
Applications: IHC, IHC-P
NBP2-92503
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80261
Applications: ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
H00010559-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009514-B01P
Species: Hu, Mu
Applications: WB
MAB6158
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5486
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
DSHBG0B
Species: Hu
Applications: ELISA
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-62583
Species: Hu
Applications: WB
H00025830-M02
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02) (0)

There are no publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02) (0)

There are no reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytosolic Sulfotransferase 4A1/SULT4A1 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02)

Discover more about diseases related to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02).
 

Pathways for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02)

Learn more about PTMs related to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02).

Blogs on Cytosolic Sulfotransferase 4A1/SULT4A1

There are no specific blogs for Cytosolic Sulfotransferase 4A1/SULT4A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (3C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT4A1
Entrez
Uniprot