Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (3C1) Summary
Immunogen |
SULT4A1 (NP_055166.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK |
Specificity |
SULT4A1 - sulfotransferase family 4A, member 1 (3C1) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SULT4A1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody Reactive against transfected lysate and Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (3C1)
Background
This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, S-ELISA
Publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02) (0)
There are no publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02) (0)
There are no reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cytosolic Sulfotransferase 4A1/SULT4A1 Products
Bioinformatics Tool for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02)
Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02)
Discover more about diseases related to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02).
| | Pathways for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02)
View related products by pathway.
|
PTMs for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02)
Learn more about PTMs related to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (H00025830-M02).
|
Blogs on Cytosolic Sulfotransferase 4A1/SULT4A1