Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (2E5) - Azide and BSA Free

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (2E5) [H00006820-M03] - Analysis of SULT2B1 expression in MCF-7 (Cat # L046V1).

Sandwich ELISA: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (2E5) [H00006820-M03] - Detection limit for recombinant GST tagged SULT2B1 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (2E5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SULT2B1 (NP_814444, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS
• Specificity: Reacts with sulfotransferase family, cytosolic, 2B, member 1.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SULT2B1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate in WB and recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (2E5) - Azide and BSA Free

• Alcohol sulfotransferase
• Cytosolic Sulfotransferase 2B1
• EC 2.8.2
• EC 2.8.2.2
• HSST2
• HSST2sulfotransferase family cytosolic 2B member 1
• Hydroxysteroid sulfotransferase 2
• ST2B1
• Sulfotransferase 2B1
• sulfotransferase family, cytosolic, 2B, member 1
• SULT2B1

Background

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SULT2B1
• Entrez:
  • 6820(Human)
• Uniprot:
  • NP_814444(Human)