![Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human small intestine shows moderate granular positivity in cytoplasm in glandular cells.](http://images.novusbio.com/fullsize/Cytosolic-Sulfotransferase-1B1-SULT1B1-Antibody-Immunohistochemistry-Paraffin-NBP1-86995-img0014.jpg "Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human small intestine shows moderate granular positivity in cytoplasm in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SULT1B1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SULT1B1 |
![Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Analysis in human small intestine and pancreas tissues. Corresponding SULT1B1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cytosolic-Sulfotransferase-1B1-SULT1B1-Antibody-Immunohistochemistry-Paraffin-NBP1-86995-img0010.jpg "Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Analysis in human small intestine and pancreas tissues. Corresponding SULT1B1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human cerebellum shows moderate positivity in cytoplasm granular in Purkinje cells.](http://images.novusbio.com/fullsize/Cytosolic-Sulfotransferase-1B1-SULT1B1-Antibody-Immunohistochemistry-Paraffin-NBP1-86995-img0011.jpg "Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human cerebellum shows moderate positivity in cytoplasm granular in Purkinje cells.")
![Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human colon shows weak granular positivity in cytoplasm in glandular cells.](http://images.novusbio.com/fullsize/Cytosolic-Sulfotransferase-1B1-SULT1B1-Antibody-Immunohistochemistry-Paraffin-NBP1-86995-img0012.jpg "Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human colon shows weak granular positivity in cytoplasm in glandular cells.")
![Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Cytosolic-Sulfotransferase-1B1-SULT1B1-Antibody-Immunohistochemistry-Paraffin-NBP1-86995-img0013.jpg "Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")