Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody

Images

 
Western Blot: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human ...read more
Immunocytochemistry/ Immunofluorescence: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-86995] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULT1B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cytosolic Sulfotransferase 1B1/SULT1B1 Protein (NBP1-86995PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody

  • Cytosolic Sulfotransferase 1B1
  • EC 2.8.2
  • EC 2.8.2.-
  • EC 2.8.2.1
  • EC 2.8.2.4
  • MGC13356
  • ST1B1
  • ST1B2
  • ST1B2sulfotransferase family cytosolic 1B member 1
  • Sulfotransferase 1B1
  • Sulfotransferase 1B2
  • sulfotransferase family, cytosolic, 1B, member 1
  • SULT1B1
  • SULT1B2
  • Thyroid hormone sulfotransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00486
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
MAB5545
Species: Hu
Applications: WB
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-31904
Species: Hu
Applications: WB, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
MAB5826
Species: Hu
Applications: WB, IHC
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59786
Species: Hu
Applications: WB
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995) (0)

There are no publications for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995) (0)

There are no reviews for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytosolic Sulfotransferase 1B1/SULT1B1 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995)

Discover more about diseases related to Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995).
 

Pathways for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995)

Learn more about PTMs related to Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody (NBP1-86995).

Blogs on Cytosolic Sulfotransferase 1B1/SULT1B1

There are no specific blogs for Cytosolic Sulfotransferase 1B1/SULT1B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1B1
Entrez