Recombinant Human Cytohesin 4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Cytohesin 4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-394 of Human PSCD4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CYTH4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
72.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytohesin 4 Protein

  • CYT4PH, SEC7 and coiled-coil domain-containing protein 4
  • cytohesin 4
  • cytohesin-4
  • pleckstrin homology, Sec7 and coiled/coil domains 4
  • pleckstrin homology, Sec7 and coiled-coil domains 4
  • PSCD4DJ63G5.1

Background

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The structures of this gene and CYTH1 are very similar. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22514
Species: Hu, Mu
Applications: WB (-), WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-90097
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25200
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr
H00000381-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NLS418
Species: Hu
Applications: IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, ICC
H00027128-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Cytohesin 4 Recombinant Protein (H00027128-P01) (0)

There are no publications for Cytohesin 4 Recombinant Protein (H00027128-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytohesin 4 Recombinant Protein (H00027128-P01) (0)

There are no reviews for Cytohesin 4 Recombinant Protein (H00027128-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytohesin 4 Recombinant Protein (H00027128-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytohesin 4 Products

Bioinformatics Tool for Cytohesin 4 Recombinant Protein (H00027128-P01)

Discover related pathways, diseases and genes to Cytohesin 4 Recombinant Protein (H00027128-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytohesin 4 Recombinant Protein (H00027128-P01)

Discover more about diseases related to Cytohesin 4 Recombinant Protein (H00027128-P01).
 

Pathways for Cytohesin 4 Recombinant Protein (H00027128-P01)

View related products by pathway.

PTMs for Cytohesin 4 Recombinant Protein (H00027128-P01)

Learn more about PTMs related to Cytohesin 4 Recombinant Protein (H00027128-P01).

Blogs on Cytohesin 4

There are no specific blogs for Cytohesin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
Cytohesin 4 Antibody
20610002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytohesin 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYTH4