Cytohesin 4 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Cytohesin 4 Partial Recombinant Protein Summary

Description
Cytohesin 4 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLL
Preparation
Method
in vitro wheat germ expression system
Gene
CYTH4

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytohesin 4 Partial Recombinant Protein

  • CYT4PH, SEC7 and coiled-coil domain-containing protein 4
  • cytohesin 4
  • cytohesin-4
  • pleckstrin homology, Sec7 and coiled/coil domains 4
  • pleckstrin homology, Sec7 and coiled-coil domains 4
  • PSCD4DJ63G5.1

Background

PSCD4 - pleckstrin homology, Sec7 and coiled-coil domains 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90097
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
H00005662-B01P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-32654
Species: Hu
Applications: IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4867R
Species: Hu
Applications: Flow
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25200
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr
H00000381-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NLS415
Species: Hu, Mk
Applications: IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01) (0)

There are no publications for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01) (0)

There are no reviews for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytohesin 4 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01)

Discover related pathways, diseases and genes to Cytohesin 4 Partial Recombinant Protein (H00027128-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01)

Discover more about diseases related to Cytohesin 4 Partial Recombinant Protein (H00027128-Q01).
 

Pathways for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01)

View related products by pathway.

PTMs for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01)

Learn more about PTMs related to Cytohesin 4 Partial Recombinant Protein (H00027128-Q01).

Blogs on Cytohesin 4

There are no specific blogs for Cytohesin 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CYTH4

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00027128-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106