Recombinant Human Cytohesin 4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cytohesin 4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 89 of Human PSCD4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CYTH4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytohesin 4 Protein

  • CYT4PH, SEC7 and coiled-coil domain-containing protein 4
  • cytohesin 4
  • cytohesin-4
  • pleckstrin homology, Sec7 and coiled/coil domains 4
  • pleckstrin homology, Sec7 and coiled-coil domains 4
  • PSCD4DJ63G5.1

Background

PSCD4 - pleckstrin homology, Sec7 and coiled-coil domains 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90097
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
H00000381-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NLS418
Species: Hu
Applications: IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
H00027128-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01) (0)

There are no publications for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01) (0)

There are no reviews for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytohesin 4 Products

Bioinformatics Tool for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01)

Discover related pathways, diseases and genes to Cytohesin 4 Partial Recombinant Protein (H00027128-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01)

Discover more about diseases related to Cytohesin 4 Partial Recombinant Protein (H00027128-Q01).
 

Pathways for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01)

View related products by pathway.

PTMs for Cytohesin 4 Partial Recombinant Protein (H00027128-Q01)

Learn more about PTMs related to Cytohesin 4 Partial Recombinant Protein (H00027128-Q01).

Blogs on Cytohesin 4

There are no specific blogs for Cytohesin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
Cytohesin 4 Antibody
20610002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytohesin 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYTH4