Cytochrome P450 2E1 Antibody

Western Blot: Cytochrome P450 2E1 Antibody [H00001571-B01P] - Analysis of CYP2E1 expression in human liver.

Immunocytochemistry/Immunofluorescence: Cytochrome P450 2E1 Antibody [H00001571-B01P] - Analysis of purified antibody to CYP2E1 on HeLa cell. (antibody concentration 10 ug/ml)

Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [H00001571-B01P] - Analysis of purified antibody to CYP2E1 on formalin-fixed paraffin-embedded human liver. (antibody concentration 3 ug/ml)

Western Blot: Cytochrome P450 2E1 Antibody [H00001571-B01P] - Analysis of CYP2E1 expression in transfected 293T cell line by CYP2E1 polyclonal antibody. Lane 1: CYP2E1 transfected lysate(54.23 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Cytochrome P450 2E1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CYP2E1 (NP_000764.1, 1 a.a. - 493 a.a.) full-length human protein. MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CYP2E1
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: It has been used for WB and IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytochrome P450 2E1 Antibody

• 4-nitrophenol 2-hydroxylase
• CPE1
• CYP2Ecytochrome P450 2E1
• CYPIIE1
• cytochrome P450, family 2, subfamily E, polypeptide 1
• cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1
• Cytochrome P450-J
• EC 1.14.13.-
• EC 1.14.13.n7
• EC 1.14.14.1
• flavoprotein-linked monooxygenase
• microsomal monooxygenase
• P450C2E
• P450-J
• xenobiotic monooxygenase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYP2E1
• Uniprot:
  • NP_000764.1(Human)