Cytochrome b reductase 1 Antibody

Images

 
Western Blot: Cytochrome b reductase 1 Antibody [NBP1-84291] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Cytochrome b reductase 1 Antibody [NBP1-84291] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytochrome b reductase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYBRD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytochrome b reductase 1 Protein (NBP1-84291PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytochrome b reductase 1 Antibody

  • cytochrome b reductase 1
  • DCYTBFRRS3FLJ23462
  • Duodenal cytochrome b
  • Ferric-chelate reductase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
MAB7509
Species: Hu
Applications: WB, IHC
NBP1-85483
Species: Hu
Applications: IHC, IHC-P
NBP1-21502
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-83422
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
E2-616
Species: Hu
MAB3120
Species: Hu
Applications: WB, Simple Western
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-84291
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cytochrome b reductase 1 Antibody (NBP1-84291) (0)

There are no publications for Cytochrome b reductase 1 Antibody (NBP1-84291).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome b reductase 1 Antibody (NBP1-84291) (0)

There are no reviews for Cytochrome b reductase 1 Antibody (NBP1-84291). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome b reductase 1 Antibody (NBP1-84291) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome b reductase 1 Products

Bioinformatics Tool for Cytochrome b reductase 1 Antibody (NBP1-84291)

Discover related pathways, diseases and genes to Cytochrome b reductase 1 Antibody (NBP1-84291). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome b reductase 1 Antibody (NBP1-84291)

Discover more about diseases related to Cytochrome b reductase 1 Antibody (NBP1-84291).
 

Pathways for Cytochrome b reductase 1 Antibody (NBP1-84291)

View related products by pathway.

PTMs for Cytochrome b reductase 1 Antibody (NBP1-84291)

Learn more about PTMs related to Cytochrome b reductase 1 Antibody (NBP1-84291).

Blogs on Cytochrome b reductase 1

There are no specific blogs for Cytochrome b reductase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome b reductase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYBRD1