Cytochrome b reductase 1 Antibody


Orthogonal Strategies: Western Blot: Cytochrome b reductase 1 Antibody [NBP1-84291] - Analysis in human cell lines SK-MEL-30 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading more
Immunohistochemistry-Paraffin: Cytochrome b reductase 1 Antibody [NBP1-84291] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Cytochrome b reductase 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM
Specificity of human Cytochrome b reductase 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytochrome b reductase 1 Protein (NBP1-84291PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cytochrome b reductase 1 Antibody

  • cytochrome b reductase 1
  • Duodenal cytochrome b
  • Ferric-chelate reductase 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cytochrome b reductase 1 Antibody (NBP1-84291) (0)

There are no publications for Cytochrome b reductase 1 Antibody (NBP1-84291).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome b reductase 1 Antibody (NBP1-84291) (0)

There are no reviews for Cytochrome b reductase 1 Antibody (NBP1-84291). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome b reductase 1 Antibody (NBP1-84291) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytochrome b reductase 1 Products

Bioinformatics Tool for Cytochrome b reductase 1 Antibody (NBP1-84291)

Discover related pathways, diseases and genes to Cytochrome b reductase 1 Antibody (NBP1-84291). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome b reductase 1 Antibody (NBP1-84291)

Discover more about diseases related to Cytochrome b reductase 1 Antibody (NBP1-84291).

Pathways for Cytochrome b reductase 1 Antibody (NBP1-84291)

View related products by pathway.

PTMs for Cytochrome b reductase 1 Antibody (NBP1-84291)

Learn more about PTMs related to Cytochrome b reductase 1 Antibody (NBP1-84291).

Blogs on Cytochrome b reductase 1

There are no specific blogs for Cytochrome b reductase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytochrome b reductase 1 Antibody and receive a gift card or discount.


Gene Symbol CYBRD1