Cysteine Conjugate beta-Lyase/CCBL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Cysteine Conjugate beta-Lyase/CCBL1 Antibody [NBP1-83317] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: Cysteine Conjugate beta-Lyase/CCBL1 Antibody [NBP1-83317] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cysteine Conjugate beta-Lyase/CCBL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cysteine Conjugate beta-Lyase/CCBL1 Antibody - BSA Free (NBP1-83317) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Cysteine Conjugate beta-Lyase/CCBL1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KYAT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC, WB reported in scientific literature (PMID: 23451256). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cysteine Conjugate beta-Lyase/CCBL1 Protein (NBP1-83317PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%). Reactivity reported in scientific literature (PMID: 23451256)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cysteine Conjugate beta-Lyase/CCBL1 Antibody - BSA Free

• CCBL1
• Cysteine Conjugate betaLyase
• Cysteine Conjugate beta-Lyase
• cysteine conjugate-beta lyase, cytoplasmic
• cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K
• Cysteine-S-conjugate beta-lyase
• EC 2.6.1.64
• EC 2.6.1.7
• EC 4.4.1.13
• FLJ95217
• Glutamine Transaminase K
• glutamine-phenylpyruvate aminotransferase
• Glutamine--phenylpyruvate transaminase
• GTKMGC29624
• KAT1
• KATI
• KATIbeta-lysase, kidney
• Kyneurenine Aminotransferase I
• kyneurenine aminotransferase
• kyneurenine aminotransferase)
• Kynurenine aminotransferase I
• kynurenine--oxoglutarate transaminase 1
• Kynurenine--oxoglutarate transaminase I

Background

CCBL1 encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317)(1)

Publication using NBP1-83317

• van Steenbeek FG, Van den Bossche L, Grinwis GC et al. Aberrant Gene Expression in Dogs with Portosystemic Shunts. PLoS One 2013-01-01 [PMID: 23451256] (WB, IF/IHC)

Bioinformatics

• Gene Symbol: KYAT1