Cysteine Conjugate beta-Lyase/CCBL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cysteine Conjugate beta-Lyase/CCBL1 Antibody [NBP1-83317] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Cysteine Conjugate beta-Lyase/CCBL1 Antibody [NBP1-83317] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cysteine Conjugate beta-Lyase/CCBL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCBL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cysteine Conjugate beta-Lyase/CCBL1 Protein (NBP1-83317PEP)
Publications
Read Publication using NBP1-83317.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%). Reactivity reported in scientific literature (PMID: 23451256)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cysteine Conjugate beta-Lyase/CCBL1 Antibody

  • CCBL1
  • Cysteine Conjugate betaLyase
  • Cysteine Conjugate beta-Lyase
  • cysteine conjugate-beta lyase, cytoplasmic
  • cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K
  • Cysteine-S-conjugate beta-lyase
  • EC 2.6.1.64
  • EC 2.6.1.7
  • EC 4.4.1.13
  • FLJ95217
  • Glutamine Transaminase K
  • glutamine-phenylpyruvate aminotransferase
  • Glutamine--phenylpyruvate transaminase
  • GTKMGC29624
  • KAT1
  • KATI
  • KATIbeta-lysase, kidney
  • Kyneurenine Aminotransferase I
  • kyneurenine aminotransferase
  • kyneurenine aminotransferase)
  • Kynurenine aminotransferase I
  • kynurenine--oxoglutarate transaminase 1
  • Kynurenine--oxoglutarate transaminase I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1103
Species: Hu
Applications: WB, IHC, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-82862
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47761
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317)(1)

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317) (0)

There are no reviews for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cysteine Conjugate beta-Lyase/CCBL1 Products

Bioinformatics Tool for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317)

Discover related pathways, diseases and genes to Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317)

Discover more about diseases related to Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317).
 

Pathways for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (NBP1-83317)

View related products by pathway.

Blogs on Cysteine Conjugate beta-Lyase/CCBL1

There are no specific blogs for Cysteine Conjugate beta-Lyase/CCBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cysteine Conjugate beta-Lyase/CCBL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCBL1
Entrez