We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Cystatin B/Stefin B Antibody - BSA Free

Images

 
Orthogonal Strategies: Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430] - Analysis in human cell lines A-431 and U-251MG using anti-CSTB antibody. Corresponding CSTB RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-557
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Analysis in human esophagus and skeletal muscle tissues. Corresponding Cystatin B/Stefin B RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human liver shows no positivity in hepatocytes.as expected.
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human tonsil shows moderate to strong nuclear and cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Cystatin B/Stefin B Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSTB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cystatin B/Stefin B Protein (NBP1-85430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Cystatin B/Stefin B Antibody - BSA Free

  • CPI-B
  • CST6cystatin B (liver thiol proteinase inhibitor)10STFBcystatin-B
  • CSTB
  • cystatin B (stefin B)
  • Cystatin B
  • EPM1
  • Liver thiol proteinase inhibitor
  • PME
  • Stefin B
  • stefin-B

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MSCTC0
Species: Mu, Rt
Applications: ELISA
NBP2-15343
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF965
Species: Mu
Applications: IHC, Neut, WB
DY8198-05
Species: Hu
Applications: ELISA
NBP1-86989
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF4709
Species: Mu
Applications: IP, WB
NBP1-86989
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1013
Species: Mu
Applications: IHC, IP, WB
4308-SE
Species: Hu
Applications: EnzAct
NBP3-38363
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-94901
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2199
Species: Hu
Applications: IP, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1183
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, Neut, WB

Publications for Cystatin B/Stefin B Antibody (NBP1-85430) (0)

There are no publications for Cystatin B/Stefin B Antibody (NBP1-85430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin B/Stefin B Antibody (NBP1-85430) (0)

There are no reviews for Cystatin B/Stefin B Antibody (NBP1-85430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cystatin B/Stefin B Antibody (NBP1-85430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin B/Stefin B Products

Research Areas for Cystatin B/Stefin B Antibody (NBP1-85430)

Find related products by research area.

Blogs on Cystatin B/Stefin B

There are no specific blogs for Cystatin B/Stefin B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin B/Stefin B Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CSTB