Cystatin B/Stefin B Antibody - BSA Free

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430] - Analysis in human cell lines A-431 and U-251MG using anti-CSTB antibody. Corresponding CSTB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.

Western Blot: Cystatin B/Stefin B Antibody [NBP1-85430] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-557

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Analysis in human esophagus and skeletal muscle tissues. Corresponding Cystatin B/Stefin B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human liver shows no positivity in hepatocytes.as expected.

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human tonsil shows moderate to strong nuclear and cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-85430] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cystatin B/Stefin B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSTB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Cystatin B/Stefin B Protein (NBP1-85430PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cystatin B/Stefin B Antibody - BSA Free

• CPI-B
• CST6cystatin B (liver thiol proteinase inhibitor)10STFBcystatin-B
• CSTB
• cystatin B (stefin B)
• Cystatin B
• EPM1
• Liver thiol proteinase inhibitor
• PME
• Stefin B
• stefin-B

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSTB