Cyclophilin 40 Recombinant Protein Antigen

Images

 
There are currently no images for Cyclophilin 40 Protein (NBP1-85363PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cyclophilin 40 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPID.

Source: E. coli

Amino Acid Sequence: FITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPID
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85363.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cyclophilin 40 Recombinant Protein Antigen

  • 40 kDa peptidyl-prolyl cis-trans isomerase D
  • 40 kDa peptidyl-prolyl cis-trans isomerase
  • cyclophilin D
  • cyclophilin-40
  • Cyclophilin-related protein
  • CYP40
  • CYP-40cyclophilin 40
  • CYPD
  • EC 5.2.1.8
  • MGC33096
  • peptidyl-prolyl cis-trans isomerase D
  • peptidylprolyl isomerase D (cyclophilin D)
  • peptidylprolyl isomerase D
  • PPIase D
  • Rotamase D

Background

Immunophilins are a family of soluble cytosolic receptors capable of binding to one of two major immunosuppressant agents: cyclosporin A (CsA) or FK506. Proteins that bind FK506 are termed FK506 Binding Proteins (FKBPs) and those that bind cyclosporin A are called cyclophilins (CyP). Both CyP:CsA and FKBP:FK506 complexes have been shown to inhibit calcineurin, a calcium and calmodulin dependent protein phosphatase which has been implicated as an important signaling enzyme in T-cell activation, providing a possible mechanism of immunosuppression by CsA and FK506. Immunophilins function as peptidyl prolyl cis-trans-isomerases (PPIase) whose activity is inhibited by their respective immunosuppressant compounds. As PPIase's, immunophilins accelerate folding of some proteins both in vivo and in vitro by catalyzing slow steps in the initial folding and rearrangement of proline containing proteins. CyP 40, a 40 kDa protein, shares significant homology with smaller CyPA (CyP 18) and FKBP59. CyP 40 exhibits the characteristic CsA binding and isomerase activity of CyP 18, though these activities appear to be less with CyP 40 than with Cyp 18. Like FKBP59, CyP 40 has been found in progesterone receptor complexes. CyP 40 is expressed at similar levels in many tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP3-35061
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45382
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-15079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: ICC/IF, WB
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC,  IHC-P, KD, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00007178-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
NBP1-85363PEP
Species: Hu
Applications: AC

Publications for Cyclophilin 40 Protein (NBP1-85363PEP) (0)

There are no publications for Cyclophilin 40 Protein (NBP1-85363PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclophilin 40 Protein (NBP1-85363PEP) (0)

There are no reviews for Cyclophilin 40 Protein (NBP1-85363PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cyclophilin 40 Protein (NBP1-85363PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cyclophilin 40 Products

Research Areas for Cyclophilin 40 Protein (NBP1-85363PEP)

Find related products by research area.

Blogs on Cyclophilin 40

There are no specific blogs for Cyclophilin 40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cyclophilin 40 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPID