Cyclin T1 Recombinant Protein Antigen

Images

 
There are currently no images for Cyclin T1 Recombinant Protein Antigen (NBP3-05509PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cyclin T1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cyclin T1.

Source: E. coli

Amino Acid Sequence: KTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLEN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCNT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05509.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cyclin T1 Recombinant Protein Antigen

  • CCNT
  • CCNT1
  • CCNTcyclin-T
  • CDK9-associated C-type protein
  • cyclin C-related protein
  • cyclin T1
  • cyclin T1b
  • Cyclin-T
  • cyclin-T1
  • CYCT1
  • HIVE1
  • human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
  • Human immunodeficiency virus-1 expression
  • subunit of positive elongation transcription factor b

Background

Cyclin T1 belongs to the cyclin family and is a primary regulator of CDK kinases. More specifically, this cyclin associates with CDK9 complex, also known as transcription elongation factor B (P-TEFb). This complex allows for the transcription of viral genes and is also involved in the regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit. Cyclin interacts with HIV-1, HIV-2, Tat and has a high affinity to TAR.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-48860
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-79286
Species: Rt
Applications: WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87592
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, KO, WB
NBP1-71867
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-06519
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-581
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-05509PEP
Species: Hu
Applications: AC

Publications for Cyclin T1 Recombinant Protein Antigen (NBP3-05509PEP) (0)

There are no publications for Cyclin T1 Recombinant Protein Antigen (NBP3-05509PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin T1 Recombinant Protein Antigen (NBP3-05509PEP) (0)

There are no reviews for Cyclin T1 Recombinant Protein Antigen (NBP3-05509PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cyclin T1 Recombinant Protein Antigen (NBP3-05509PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cyclin T1 Products

Research Areas for Cyclin T1 Recombinant Protein Antigen (NBP3-05509PEP)

Find related products by research area.

Blogs on Cyclin T1

There are no specific blogs for Cyclin T1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cyclin T1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNT1