Cyclin T1 Antibody Summary
| Immunogen |
CCNT1 (NP_001231, 321 a.a. - 420 a.a.) partial recombinant protein with GST tag. SNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY |
| Specificity |
CCNT1 - cyclin T1 |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CCNT1 |
| Purity |
Unpurified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 % glycerol |
| Preservative |
No Preservative |
| Purity |
Unpurified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Cyclin T1 Antibody
Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Mu
Applications: ICC, IHC, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Publications for Cyclin T1 Antibody (H00000904-A01) (0)
There are no publications for Cyclin T1 Antibody (H00000904-A01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cyclin T1 Antibody (H00000904-A01) (0)
There are no reviews for Cyclin T1 Antibody (H00000904-A01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Cyclin T1 Antibody (H00000904-A01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cyclin T1 Products
Research Areas for Cyclin T1 Antibody (H00000904-A01)
Find related products by research area.
|
Blogs on Cyclin T1