Cyclin G Antibody

Images

 
Western Blot: Cyclin G Antibody [NBP2-86608] - WB Suggested Anti-CCNG1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: MCF7 cell lysate
Immunohistochemistry-Paraffin: Cyclin G Antibody [NBP2-86608] - Rabbit Anti-CCNG1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Nucleus. Primary Antibody Concentration: 1:100. ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclin G Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human Cyclin G. Peptide sequence: IEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CCNG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cyclin G Antibody

  • CCNG
  • CYCG1
  • cyclin G1
  • cyclin-G
  • cyclin-G1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
AF1555
Species: Hu
Applications: WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-74359
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
H00003429-A01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-87518
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Cyclin G Antibody (NBP2-86608) (0)

There are no publications for Cyclin G Antibody (NBP2-86608).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin G Antibody (NBP2-86608) (0)

There are no reviews for Cyclin G Antibody (NBP2-86608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cyclin G Antibody (NBP2-86608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclin G Products

Bioinformatics Tool for Cyclin G Antibody (NBP2-86608)

Discover related pathways, diseases and genes to Cyclin G Antibody (NBP2-86608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin G Antibody (NBP2-86608)

Discover more about diseases related to Cyclin G Antibody (NBP2-86608).
 

Pathways for Cyclin G Antibody (NBP2-86608)

View related products by pathway.

PTMs for Cyclin G Antibody (NBP2-86608)

Learn more about PTMs related to Cyclin G Antibody (NBP2-86608).
 

Research Areas for Cyclin G Antibody (NBP2-86608)

Find related products by research area.

Blogs on Cyclin G

There are no specific blogs for Cyclin G, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclin G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNG1