Cyclin D2 Antibody - Azide and BSA Free

Western Blot: Cyclin D2 Antibody [H00000894-B01P] - Analysis of CCND2 expression in human placenta.

Western Blot: Cyclin D2 Antibody [H00000894-B01P] - Analysis of CCND2 expression in A-431.

Western Blot: Cyclin D2 Antibody [H00000894-B01P] - Analysis of CCND2 expression in transfected 293T cell line by CCND2 polyclonal antibody. Lane 1: CCND2 transfected lysate(31.79 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Cyclin D2 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CCND2 (NP_001750.1, 1 a.a. - 289 a.a.) full-length human protein. MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
• Specificity: CCND2 - cyclin D2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CCND2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cyclin D2 Antibody - Azide and BSA Free

• CCND2
• Cyclin D2
• G1/S-specific cyclin D2
• G1/S-specific cyclin-D2
• KIAK0002
• MGC102758
• Vin1

Background

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cyclin D2 Antibody (H00000894-B01P)(1)

Publication using H00000894-B01P

• Rangrez AY, Pott J, Kluge A et al. Myeloid leukemia factor-1 is a novel modulator of neonatal rat cardiomyocyte proliferation. Biochim Biophys Acta 2017-01-10 [PMID: 28087342]

Bioinformatics

• Gene Symbol: CCND2
• Entrez:
  • 894(Human)
• Uniprot:
  • NP_001750.1(Human)