Recombinant Human CXX1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CXX1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-209 of Human FAM127A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RTL8C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
48.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CXX1 GST (N-Term) Protein

  • CAAX box 1
  • Cerebral protein 5
  • CXX1MAR8
  • family with sequence similarity 127, member A
  • Mammalian retrotransposon derived protein 8C
  • Mar8
  • MAR8CMGC117411
  • MART8
  • MART8C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-32871
Species: Ca, Hu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
5396-SF
Species: Hu
Applications: BA
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF3264
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-49538
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-00248
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-15267
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB

Publications for CXX1 Recombinant Protein (H00008933-P02) (0)

There are no publications for CXX1 Recombinant Protein (H00008933-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXX1 Recombinant Protein (H00008933-P02) (0)

There are no reviews for CXX1 Recombinant Protein (H00008933-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXX1 Recombinant Protein (H00008933-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CXX1 Products

Bioinformatics Tool for CXX1 Recombinant Protein (H00008933-P02)

Discover related pathways, diseases and genes to CXX1 Recombinant Protein (H00008933-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXX1 Recombinant Protein (H00008933-P02)

Discover more about diseases related to CXX1 Recombinant Protein (H00008933-P02).
 

Pathways for CXX1 Recombinant Protein (H00008933-P02)

View related products by pathway.

PTMs for CXX1 Recombinant Protein (H00008933-P02)

Learn more about PTMs related to CXX1 Recombinant Protein (H00008933-P02).
 

Research Areas for CXX1 Recombinant Protein (H00008933-P02)

Find related products by research area.

Blogs on CXX1

There are no specific blogs for CXX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CXX1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RTL8C