CTAGE5 Antibody

Images

 
Western Blot: CTAGE5 Antibody [NBP1-85390] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
Immunohistochemistry-Paraffin: CTAGE5 Antibody [NBP1-85390] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTAGE5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTAGE5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CTAGE5 Protein (NBP1-85390PEP)
Publications
Read Publication using NBP1-85390.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CTAGE5 Antibody

  • cTAGE family member 5
  • CTAGE family, member 5
  • cTAGE-5A
  • cTAGE-5D
  • cutaneous T-cell lymphoma-associated antigen 5
  • MEA11
  • MEA6cTAGE-5B
  • meningioma expressed antigen 6 (coiled-coil proline-rich)
  • Meningioma-expressed antigen 6/11
  • MGEA
  • MGEA11cTAGE-5C
  • MGEA6
  • Protein cTAGE-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00006575-M04
Species: Hu
Applications: WB, ELISA
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-03455
Species: Hu
Applications: WB, ICC/IF
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79749
Species: Hu
Applications: WB
NBP1-85390
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CTAGE5 Antibody (NBP1-85390)(1)

Reviews for CTAGE5 Antibody (NBP1-85390) (0)

There are no reviews for CTAGE5 Antibody (NBP1-85390). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTAGE5 Antibody (NBP1-85390) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTAGE5 Products

Bioinformatics Tool for CTAGE5 Antibody (NBP1-85390)

Discover related pathways, diseases and genes to CTAGE5 Antibody (NBP1-85390). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTAGE5 Antibody (NBP1-85390)

Discover more about diseases related to CTAGE5 Antibody (NBP1-85390).
 

Pathways for CTAGE5 Antibody (NBP1-85390)

View related products by pathway.

Blogs on CTAGE5

There are no specific blogs for CTAGE5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTAGE5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTAGE5