CTAGE5 Antibody

Images

 
Western Blot: CTAGE5 Antibody [NBP1-85390] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431
Immunohistochemistry-Paraffin: CTAGE5 Antibody [NBP1-85390] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

CTAGE5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTAGE5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
CTAGE5 Protein (NBP1-85390PEP)
Publications
Read Publication using NBP1-85390.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Alternate Names for CTAGE5 Antibody

  • cTAGE family member 5
  • CTAGE family, member 5
  • cTAGE-5A
  • cTAGE-5D
  • cutaneous T-cell lymphoma-associated antigen 5
  • MEA11
  • MEA6cTAGE-5B
  • meningioma expressed antigen 6 (coiled-coil proline-rich)
  • Meningioma-expressed antigen 6/11
  • MGEA
  • MGEA11cTAGE-5C
  • MGEA6
  • Protein cTAGE-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-69702
Species: Hu
Applications: WB
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-03455
Species: Hu
Applications: WB, ICC/IF
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-88263
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31370
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-79749
Species: Hu
Applications: WB

Publications for CTAGE5 Antibody (NBP1-85390)(1)

Reviews for CTAGE5 Antibody (NBP1-85390) (0)

There are no reviews for CTAGE5 Antibody (NBP1-85390). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTAGE5 Antibody (NBP1-85390) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTAGE5 Antibody Products

Related Products by Gene

Bioinformatics Tool for CTAGE5 Antibody (NBP1-85390)

Discover related pathways, diseases and genes to CTAGE5 Antibody (NBP1-85390). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTAGE5 Antibody (NBP1-85390)

Discover more about diseases related to CTAGE5 Antibody (NBP1-85390).
 

Pathways for CTAGE5 Antibody (NBP1-85390)

View related products by pathway.

Blogs on CTAGE5

There are no specific blogs for CTAGE5, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CTAGE5

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-85390 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought