Recombinant Human CSH2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CSH2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-217 of Human CSH2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CSH2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CSH2 Protein

  • chorionic somatomammotropin B
  • chorionic somatomammotropin hormone 2
  • CS-2
  • CSBChoriomammotropin
  • hCS-B
  • Lactogen
  • PL
  • Placental lactogen

Background

The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-46376
Species: Hu
Applications: WB, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45519
Species: Hu
Applications: WB, IHC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
MAB4169
Species: Hu
Applications: WB, IHC
H00093659-T01
Species: Hu
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for CSH2 Recombinant Protein (H00001443-P01) (0)

There are no publications for CSH2 Recombinant Protein (H00001443-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSH2 Recombinant Protein (H00001443-P01) (0)

There are no reviews for CSH2 Recombinant Protein (H00001443-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSH2 Recombinant Protein (H00001443-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CSH2 Products

Bioinformatics Tool for CSH2 Recombinant Protein (H00001443-P01)

Discover related pathways, diseases and genes to CSH2 Recombinant Protein (H00001443-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSH2 Recombinant Protein (H00001443-P01)

Discover more about diseases related to CSH2 Recombinant Protein (H00001443-P01).
 

Pathways for CSH2 Recombinant Protein (H00001443-P01)

View related products by pathway.

PTMs for CSH2 Recombinant Protein (H00001443-P01)

Learn more about PTMs related to CSH2 Recombinant Protein (H00001443-P01).

Blogs on CSH2

There are no specific blogs for CSH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CSH2 Antibody
NBP2-16019

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CSH2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CSH2