CSGALNACT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CSGALNACT2 Antibody [NBP1-81851] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: CSGALNACT2 Antibody [NBP1-81851] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSGALNACT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLNVGARAWDKGEVLM
Specificity
Specificity of human CSGALNACT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSGALNACT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CSGALNACT2 Protein (NBP1-81851PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSGALNACT2 Antibody

  • Beta4GalNAcT-2
  • CHGN2
  • chondroitin beta1,4 N-acetylgalactosaminyltransferase 2
  • Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 2
  • chondroitin sulfate GalNAcT-2
  • chondroitin sulfate N-acetylgalactosaminyltransferase 2
  • CSGalNAcT2
  • CSGalNAcT-2
  • DKFZp686H13226
  • EC 2.4.1.174
  • FLJ43310
  • GALNACT2
  • GALNACT-2
  • GALNACT2beta 4 GalNAcT-2
  • MGC40204
  • PRO0082

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20261
Species: Hu
Applications: WB, ICC/IF
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56242
Species: Hu
Applications: ICC/IF
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29948
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91875
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-81851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CSGALNACT2 Antibody (NBP1-81851) (0)

There are no publications for CSGALNACT2 Antibody (NBP1-81851).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSGALNACT2 Antibody (NBP1-81851) (0)

There are no reviews for CSGALNACT2 Antibody (NBP1-81851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CSGALNACT2 Antibody (NBP1-81851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CSGALNACT2 Antibody (NBP1-81851)

Discover related pathways, diseases and genes to CSGALNACT2 Antibody (NBP1-81851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSGALNACT2 Antibody (NBP1-81851)

Discover more about diseases related to CSGALNACT2 Antibody (NBP1-81851).
 

Pathways for CSGALNACT2 Antibody (NBP1-81851)

View related products by pathway.

Blogs on CSGALNACT2

There are no specific blogs for CSGALNACT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSGALNACT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSGALNACT2
Entrez