CSE1L/CAS/Exportin-2 Antibody (1W4T4)

Western Blot: CSE1L/CAS/Exportin-2 Antibody (1W4T4) [NBP3-15330] - Western blot analysis of extracts of various cell lines, using CSE1L/CAS/Exportin-2 Rabbit mAb (NBP3-15330) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu
• Applications: WB
• Clone: 1W4T4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CSE1L/CAS/Exportin-2 Antibody (1W4T4) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 872-971 of human CSE1L/CAS/Exportin-2 (P55060). LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CSE1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CSE1L/CAS/Exportin-2 Antibody (1W4T4)

• CAS
• CASMGC117283
• Cellular apoptosis susceptibility protein
• chromosome segregation 1 (yeast homolog)-like
• Chromosome segregation 1-like protein
• CSE1 chromosome segregation 1-like (yeast)
• CSE1
• CSE1L
• exp2
• exportin-2
• Importin-alpha re-exporter
• MGC130037
• XPO2
• XPO2MGC130036

Background

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSE1L