Recombinant Human CRX/CORD2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CRX/CORD2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-95 of Human CRX partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CRX

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CRX/CORD2 Protein

  • cone-rod homeobox
  • CORD2
  • CRDcone-rod homeobox protein
  • CRX
  • LCA7
  • LCA7orthodenticle homeobox 3
  • OTX3

Background

CRX - cone-rod homeobox

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2945
Species: Hu
Applications: WB
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-22568
Species: Hu
Applications: IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56113
Species: Hu
Applications: IHC-P
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00001406-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01) (0)

There are no publications for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01) (0)

There are no reviews for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRX/CORD2 Products

Bioinformatics Tool for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01)

Discover related pathways, diseases and genes to CRX/CORD2 Partial Recombinant Protein (H00001406-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01)

Discover more about diseases related to CRX/CORD2 Partial Recombinant Protein (H00001406-Q01).
 

Pathways for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01)

View related products by pathway.

PTMs for CRX/CORD2 Partial Recombinant Protein (H00001406-Q01)

Learn more about PTMs related to CRX/CORD2 Partial Recombinant Protein (H00001406-Q01).

Blogs on CRX/CORD2

There are no specific blogs for CRX/CORD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CRX/CORD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRX
Entrez