We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CRMP5 Recombinant Protein Antigen

Images

 
There are currently no images for CRMP5 Recombinant Protein Antigen (NBP2-55982PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CRMP5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRMP5.

Source: E. coli

Amino Acid Sequence: CPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DPYSL5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55982.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CRMP5 Recombinant Protein Antigen

  • Collapsin response mediator protein 5
  • collapsin response mediator protein-5
  • CRAMCRMP3-associated molecule
  • CRMP-5FLJ45383
  • CRMP5UNC33-like phosphoprotein 6
  • dihydropyrimidinase-like 5
  • dihydropyrimidinase-related protein 5
  • DRP-5
  • Ulip6
  • ULIP-6

Background

The collapsin response mediator protein (CRMP) family of proteins (also referred to as ULIP6) are a group of neurologic proteins that have been found to play key roles in growth cone guidance during neural development. CRMP5 has relatively low sequence homology with the other four members of the CRMP family. CRMP5 is expressed in the developing nervous system in an expression pattern that resembles CRMP2 and has a peak expression during the first postnatal week. Elevated levels of autoantibody to CRMP5 have been shown to be linked paraneoplastic autoimmune optic neuritis and other paraneoplastic neoplasms. Auto-immunity against CRMP5 expression (predominantly the N-terminal epitopes) is also being investigated as an oncological marker in the respiratory system and in the thymus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85447
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85448
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2299
Species: Mu
Applications: IHC, WB
1250-S3
Species: Hu
Applications: BA, BA
NBP2-13937
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86033
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76651
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-85224
Species: Hu
Applications: IHC,  IHC-P, WB
MAB5519
Species: Mu
Applications: CyTOF-ready, Flow, ICC
NBP1-87679
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-86653
Species: Hu
Applications: IHC,  IHC-P, WB
H00001996-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP3-38258
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-55982PEP
Species: Hu
Applications: AC

Publications for CRMP5 Recombinant Protein Antigen (NBP2-55982PEP) (0)

There are no publications for CRMP5 Recombinant Protein Antigen (NBP2-55982PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRMP5 Recombinant Protein Antigen (NBP2-55982PEP) (0)

There are no reviews for CRMP5 Recombinant Protein Antigen (NBP2-55982PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CRMP5 Recombinant Protein Antigen (NBP2-55982PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRMP5 Products

Research Areas for CRMP5 Recombinant Protein Antigen (NBP2-55982PEP)

Find related products by research area.

Blogs on CRMP5

There are no specific blogs for CRMP5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRMP5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DPYSL5