CRLR Antibody - BSA Free

CRLR-Antibody-Immunohistochemistry-NBP1-85643-img0004.jpg

Staining of human Pancreas shows no membranous positivity in exocrine glandular cells.

Staining of human Tonsil shows strong membranous positivity in squamous epithelial cells.

Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in distal tubules.

Staining of human Lung shows strong membranous positivity in pneumocytes.

Immunohistochemical analysis of selected genes.Immunohistochemical staining pattern of the proteins of CALCRL that was expressed at a higher level in the low risk groups and CHI3L1, SOD2 and EGFR that were expressed at a higher level in the high risk groups of glioblastoma. A) Labeling index of these four proteins between low risk and high risk patients is shown. B) CALCRL (A, B) CHI3L1 (C, D) and SOD2(E, F) show cytoplasmic staining; EGFR (G, H) shows membrane staining of tumor cells. All original magnifications are ×160. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/23646114), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CRLR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALCRL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC-P reported in scientific literature (PMID: 23646114). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CRLR Recombinant Protein Antigen (NBP1-85643PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CRLR Antibody - BSA Free

• calcitonin gene-related peptide type 1 receptor
• calcitonin receptor-like
• CALCRL
• CGRP type 1 receptor
• CGRPR
• CGRPRCRLRCalcitonin receptor-like receptor
• CRLR

Background

Calcitonin receptor-like receptor (CRLR) is an Adrenomedullin Receptor that requires two additional proteins to function: a chaperone protein RAMP (receptor activity modifying protein) and the component protein RCP. The function of CRLR depends on its interaction with RAMP. When coexpressed with RAMP1, CRLR acts as a receptor for calcitonin gene-related peptide (CGRP). In contrast, when CRLR is coexpressed with either RAMP2 or RAMP3, it acts as a receptor for adrenomedullin. Activation of the receptor leads to an increase in intracellular cyclic AMP. CRLR mediates the vasorelaxation of arteries, suggesting a potential role for the receptor in reaction to injury, particularly in the treatment of pulmonary hypertension. CRLR expression has been reported in brain, lung, blood vessel, liver, and intestinal tract. ESTs have been isolated from B-Cell/lung/testis, bone marrow, embryo, lung, and synovium libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CRLR Antibody (NBP1-85643)(1)

Publication using NBP1-85643

• Arimappamagan A, Somasundaram K, Thennarasu K et al. A Fourteen Gene GBM Prognostic Signature Identifies Association of Immune Response Pathway and Mesenchymal Subtype with High Risk Group. PLoS One 2013-01-01 [PMID: 23646114] (IHC-P, Human)

Bioinformatics

• Gene Symbol: CALCRL