CrkRS Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CrkRS Antibody [NBP1-85451] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CrkRS Antibody [NBP1-85451] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CrkRS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CrkRS Protein (NBP1-85451PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CrkRS Antibody

  • Cdc2-related kinase, arginine/serine-richCrkRS
  • Cell division cycle 2-related protein kinase 7
  • Cell division protein kinase 12
  • CRK7CDC2-related protein kinase 7
  • CRKR
  • CRKRS
  • cyclin-dependent kinase 12
  • EC 2.7.11
  • EC 2.7.11.23
  • hCDK12
  • KIAA0904EC 2.7.11.22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008621-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-06519
Species: Hu
Applications: WB, IHC-P, IP
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78296
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-46218
Species: Hu
Applications: WB, IHC
NBP2-14908
Species: Hu
Applications: WB, ICC/IF
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF5540
Species: Mu
Applications: WB
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
AF1726
Species: Hu
Applications: WB, IHC, ICC
NBP1-85451
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CrkRS Antibody (NBP1-85451) (0)

There are no publications for CrkRS Antibody (NBP1-85451).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CrkRS Antibody (NBP1-85451) (0)

There are no reviews for CrkRS Antibody (NBP1-85451). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CrkRS Antibody (NBP1-85451) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CrkRS Products

Bioinformatics Tool for CrkRS Antibody (NBP1-85451)

Discover related pathways, diseases and genes to CrkRS Antibody (NBP1-85451). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CrkRS Antibody (NBP1-85451)

Discover more about diseases related to CrkRS Antibody (NBP1-85451).
 

Pathways for CrkRS Antibody (NBP1-85451)

View related products by pathway.

PTMs for CrkRS Antibody (NBP1-85451)

Learn more about PTMs related to CrkRS Antibody (NBP1-85451).
 

Research Areas for CrkRS Antibody (NBP1-85451)

Find related products by research area.

Blogs on CrkRS

There are no specific blogs for CrkRS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CrkRS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK12