CRELD1 Recombinant Protein Antigen

Images

 
There are currently no images for CRELD1 Protein (NBP1-88917PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CRELD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRELD1.

Source: E.coli

Amino Acid Sequence: GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRELD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88917.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CRELD1 Recombinant Protein Antigen

  • atrioventricular septal defect 2
  • AVSD2
  • CIRRIN
  • CRELD1
  • cysteine-rich with EGF-like domain protein 1
  • cysteine-rich with EGF-like domains 1
  • DKFZp566D213

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24585
Species: Hu
Applications: WB, IHC-P
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3686
Species: Mu
Applications: WB
AF5310
Species: Hu, Mu
Applications: WB, ICC
MAB18401
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-57809
Species: Hu
Applications: ICC/IF
AF339
Species: Hu
Applications: WB, IHC, Block
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
AF4248
Species: Hu
Applications: WB, ICC
AF7899
Species: Hu
Applications: WB, IHC
NBP1-33479
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4539
Species: Hu, Mu, Rt
Applications: WB
NBP2-57763
Species: Hu
Applications: ICC/IF
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NLS12
Species: Hu, Po, Bt, Bv, Ca, Eq, Mk, Pm, Rb
Applications: IHC-P
NB100-78585
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88917PEP
Species: Hu
Applications: AC

Publications for CRELD1 Protein (NBP1-88917PEP) (0)

There are no publications for CRELD1 Protein (NBP1-88917PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRELD1 Protein (NBP1-88917PEP) (0)

There are no reviews for CRELD1 Protein (NBP1-88917PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CRELD1 Protein (NBP1-88917PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CRELD1 Protein (NBP1-88917PEP)

Discover related pathways, diseases and genes to CRELD1 Protein (NBP1-88917PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRELD1 Protein (NBP1-88917PEP)

Discover more about diseases related to CRELD1 Protein (NBP1-88917PEP).
 

Pathways for CRELD1 Protein (NBP1-88917PEP)

View related products by pathway.

PTMs for CRELD1 Protein (NBP1-88917PEP)

Learn more about PTMs related to CRELD1 Protein (NBP1-88917PEP).

Blogs on CRELD1

There are no specific blogs for CRELD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CRELD1 Antibody
NBP1-88917
NKX2.5 Antibody
NBP1-31558

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CRELD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CRELD1