Creatine kinase MT 1B Antibody (2C8)

Images

 
Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Analysis of CKMT1B expression in A-431 (Cat # L015V1).
Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control ...read more
Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody (M04), clone 2C8. Lane 1: CKMT1B transfected lysatE (47 ...read more
ELISA: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Detection limit for recombinant GST tagged CKMT1B is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
2C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Creatine kinase MT 1B Antibody (2C8) Summary

Immunogen
CKMT1B (NP_066270 327 a.a. - 417 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Specificity
CKMT1B - creatine kinase, mitochondrial 1B (2C8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CKMT1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and RNAi Validation.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Creatine kinase MT 1B Antibody (2C8)

  • Acidic-Type Mitochondrial Creatine Kinase
  • CKMT
  • CKMT1
  • CKMT1B
  • Creatine Kinase U-Type, Mitochondrial
  • Creatine Kinase, Mitochondrial 1 (Ubiquitous)
  • Creatine Kinase, Mitochondrial 1B
  • EC 2.7.3.2
  • Mia-CK
  • Ubiquitous Mitochondrial Creatine Kinase
  • UMTCK
  • U-MtCK

Background

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-54661
Species: Hu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00140462-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
H00001159-M04
Species: Hu
Applications: WB, ELISA, RNAi

Publications for Creatine kinase MT 1B Antibody (H00001159-M04) (0)

There are no publications for Creatine kinase MT 1B Antibody (H00001159-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Creatine kinase MT 1B Antibody (H00001159-M04) (0)

There are no reviews for Creatine kinase MT 1B Antibody (H00001159-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Creatine kinase MT 1B Antibody (H00001159-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Creatine kinase MT 1B Products

Bioinformatics Tool for Creatine kinase MT 1B Antibody (H00001159-M04)

Discover related pathways, diseases and genes to Creatine kinase MT 1B Antibody (H00001159-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Creatine kinase MT 1B Antibody (H00001159-M04)

Discover more about diseases related to Creatine kinase MT 1B Antibody (H00001159-M04).

Research Areas for Creatine kinase MT 1B Antibody (H00001159-M04)

Find related products by research area.

Blogs on Creatine kinase MT 1B

There are no specific blogs for Creatine kinase MT 1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Creatine kinase MT 1B Antibody (2C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CKMT1B
Entrez
Uniprot