Creatine kinase MT 1B Antibody (2C8) - Azide and BSA Free

Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody (M04), clone 2C8. Lane 1: CKMT1B transfected lysatE (47 KDa). Lane 2: Non-transfected lysate.

Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed H00001159-M04. GAPDH (36.1 kDa) used as loading control.

Western Blot: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Analysis of CKMT1B expression in A-431 (Cat # L015V1).

ELISA: Creatine kinase MT 1B Antibody (2C8) [H00001159-M04] - Detection limit for recombinant GST tagged CKMT1B is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, KD
• Clone: 2C8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Creatine kinase MT 1B Antibody (2C8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CKMT1B (NP_066270, 327 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
• Specificity: CKMT1B - creatine kinase, mitochondrial 1B (2C8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CKMT1B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and RNAi Validation.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Creatine kinase MT 1B Antibody (2C8) - Azide and BSA Free

• Acidic-Type Mitochondrial Creatine Kinase
• CKMT
• CKMT1
• CKMT1B
• Creatine Kinase U-Type, Mitochondrial
• Creatine Kinase, Mitochondrial 1 (Ubiquitous)
• Creatine Kinase, Mitochondrial 1B
• EC 2.7.3.2
• Mia-CK
• Ubiquitous Mitochondrial Creatine Kinase
• UMTCK
• U-MtCK

Background

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CKMT1B
• Entrez:
  • 1159(Human)
• Uniprot:
  • NP_066270(Human)