CRABP2 Antibody - BSA Free

Western Blot: CRABP2 Antibody [NBP1-85465] - Analysis in control (vector only transfected HEK293T lysate) and CRABP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: CRABP2 Antibody [NBP1-85465] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: CRABP2 Antibody [NBP1-85465] - Staining of human vulva/anal skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.

Western Blot: CRABP2 Antibody [NBP1-85465] - Analysis in human cell lines MCF-7 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CRABP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CRABP2 Antibody - BSA Free (NBP1-85465) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CRABP2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRABP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 26634247). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  CRABP2 Protein (NBP1-85465PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26634247).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CRABP2 Antibody - BSA Free

• cellular retinoic acid binding protein 2
• Cellular retinoic acid-binding protein II
• CRABP2
• CRABP-II
• CRABP-IIcellular retinoic acid-binding protein 2
• RBP6

Background

Cellular retinoic acid binding protein 2 (CRABP2) is a coactivator present in the retinoic acid (RA)-dependent nuclear complex. CRABP2 has been shown to mediate retinoic acid activity in skin to influence skin cell growth and differentiation. It has also been shown to mediate the growth suppressive effects of retinoic acid in breast cancer. CRABP2's role in cell differentiation may be linked to control of the cell-cycle since it has been identified as an interacting partner of cyclin D3 in CRABPII and RAR ternary complex. Alternate names for CRABP2 include cellular retinoic acid-binding protein II, CRABP-II, retinoic acid-binding protein II, and RBP6.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CRABP2 Antibody (NBP1-85465)(1)

Publication using NBP1-85465

• Seidensaal K, Nollert A, Feige AH et al. Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma. Mol Cancer 2015-12-03 [PMID: 26634247] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: CRABP2
• Entrez:
  • 1382(Human)
• Uniprot:
  • P29373()