CPS1 Antibody (4A10) Summary
Immunogen |
CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA |
Specificity |
CPS1 - carbamoyl-phosphate synthetase 1, mitochondrial (4A10) |
Isotype |
IgG1 Lambda |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CPS1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CPS1 Antibody (4A10)
Background
The protein encoded by this gene is an enzyme that catalyzes the first committed step of the hepatic urea cycle, which is important in the removal of excess urea from cells. There are two isozymes of this enzyme, and the encoded protein is the mitochondrial form. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ca, Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Publications for CPS1 Antibody (H00001373-M02) (0)
There are no publications for CPS1 Antibody (H00001373-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CPS1 Antibody (H00001373-M02) (0)
There are no reviews for CPS1 Antibody (H00001373-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CPS1 Antibody (H00001373-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CPS1 Products
Bioinformatics Tool for CPS1 Antibody (H00001373-M02)
Discover related pathways, diseases and genes to CPS1 Antibody (H00001373-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CPS1 Antibody (H00001373-M02)
Discover more about diseases related to CPS1 Antibody (H00001373-M02).
| | Pathways for CPS1 Antibody (H00001373-M02)
View related products by pathway.
|
PTMs for CPS1 Antibody (H00001373-M02)
Learn more about PTMs related to CPS1 Antibody (H00001373-M02).
| | Research Areas for CPS1 Antibody (H00001373-M02)
Find related products by research area.
|
Blogs on CPS1