CPS1 Antibody (4A10)

Images

 
Western Blot: CPS1 Antibody (4A10) [H00001373-M02] - CPS1 monoclonal antibody (M02), clone 4A10. Analysis of CPS1 expression in HeLa.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CPS1 Antibody (4A10) Summary

Immunogen
CPS1 (NP_001866 1400 a.a. - 1500 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
Specificity
CPS1 - carbamoyl-phosphate synthetase 1, mitochondrial (4A10)
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
CPS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPS1 Antibody (4A10)

  • carbamoyl-phosphate synthase [ammonia], mitochondrial
  • carbamoyl-phosphate synthase 1, mitochondrial
  • carbamoyl-phosphate synthetase 1, mitochondrial
  • carbamoylphosphate synthetase I
  • Carbamoyl-phosphate synthetase I
  • CPSase I
  • CPSASE1
  • EC 6.3.4.16

Background

The protein encoded by this gene is an enzyme that catalyzes the first committed step of the hepatic urea cycle, which is important in the removal of excess urea from cells. There are two isozymes of this enzyme, and the encoded protein is the mitochondrial form. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-58283
Species: Hu
Applications: ICC/IF
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00000435-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
NBP1-54974
Species: Hu
Applications: WB
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for CPS1 Antibody (H00001373-M02) (0)

There are no publications for CPS1 Antibody (H00001373-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPS1 Antibody (H00001373-M02) (0)

There are no reviews for CPS1 Antibody (H00001373-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPS1 Antibody (H00001373-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPS1 Products

Bioinformatics Tool for CPS1 Antibody (H00001373-M02)

Discover related pathways, diseases and genes to CPS1 Antibody (H00001373-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPS1 Antibody (H00001373-M02)

Discover more about diseases related to CPS1 Antibody (H00001373-M02).
 

Pathways for CPS1 Antibody (H00001373-M02)

View related products by pathway.

PTMs for CPS1 Antibody (H00001373-M02)

Learn more about PTMs related to CPS1 Antibody (H00001373-M02).

Blogs on CPS1

There are no specific blogs for CPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CPS1 RNAi
H00001373-R01-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPS1 Antibody (4A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CPS1
Entrez
Uniprot