CPEB4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CPEB4 Antibody [NBP1-81384] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: CPEB4 Antibody [NBP1-81384] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPEB4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPEB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CPEB4 Protein (NBP1-81384PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPEB4 Antibody

  • CPE-binding protein 4
  • cytoplasmic polyadenylation element binding protein 4
  • cytoplasmic polyadenylation element-binding protein 4
  • hCPEB-4
  • KIAA1673CPE-BP4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-56919
Species: Hu
Applications: WB
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56392
Species: Hu
Applications: WB, ICC/IF
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-83927
Species: Hu
Applications: IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
AF2958
Species: Hu
Applications: WB
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
AF1195
Species: Hu
Applications: WB, IHC, Neut
NBP2-30870
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CPEB4 Antibody (NBP1-81384) (0)

There are no publications for CPEB4 Antibody (NBP1-81384).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPEB4 Antibody (NBP1-81384) (0)

There are no reviews for CPEB4 Antibody (NBP1-81384). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CPEB4 Antibody (NBP1-81384) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPEB4 Products

Bioinformatics Tool for CPEB4 Antibody (NBP1-81384)

Discover related pathways, diseases and genes to CPEB4 Antibody (NBP1-81384). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPEB4 Antibody (NBP1-81384)

Discover more about diseases related to CPEB4 Antibody (NBP1-81384).
 

Pathways for CPEB4 Antibody (NBP1-81384)

View related products by pathway.

PTMs for CPEB4 Antibody (NBP1-81384)

Learn more about PTMs related to CPEB4 Antibody (NBP1-81384).

Blogs on CPEB4

There are no specific blogs for CPEB4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPEB4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPEB4