COX4 Recombinant Protein Antigen

Images

 
There are currently no images for COX4 Protein (NBP1-85498PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

COX4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COX4I1.

Source: E. coli

Amino Acid Sequence: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COX4I1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85498.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COX4 Recombinant Protein Antigen

  • COX IV-1
  • COX4
  • COX4-1
  • COX4COXIV
  • COX4I2
  • Cytochrome c oxidase polypeptide IV
  • cytochrome c oxidase subunit 4 isoform 1, mitochondrial
  • cytochrome c oxidase subunit IV isoform 1cytochrome c oxidase subunit IV
  • MGC72016

Background

COX IV (cytochrome c oxidase subunit IV isoform 1) plays a pivotal role in respiratory function and assembly of the enzyme complex. This protein is known to have interactions with MT-CO2, MCL1, TMBIM4, MT-CO1 and TH1L. COX IV has been studied in relation to anemia, Huntington's disease, Alzheimer's disease, neuronitis, pancreatitis and several other diseases and disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-89125
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-71648
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
H00084701-M01
Species: Bv, Hu, Mu, Rt
Applications: ELISA, IB, IHC,  IHC-P, IP, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP2-92927
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-93792
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-85498PEP
Species: Hu
Applications: AC

Publications for COX4 Protein (NBP1-85498PEP) (0)

There are no publications for COX4 Protein (NBP1-85498PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX4 Protein (NBP1-85498PEP) (0)

There are no reviews for COX4 Protein (NBP1-85498PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COX4 Protein (NBP1-85498PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX4 Products

Research Areas for COX4 Protein (NBP1-85498PEP)

Find related products by research area.

Blogs on COX4.

The Importance of the COX IV Antibody to Apoptosis Research
COX IV isoform 1 is a nuclear-encoded polypeptide chain of the Cytochrome C Oxidase enzyme, located on the mitochondrial inner membrane. Owing to its widespread distribution in human and mammalian tissues, COX IV antibodies are widely used as loading ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COX4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COX4I1