Coronin-1a Antibody

Images

 
Western Blot: Coronin-1a Antibody [NBP2-13861] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: Coronin-1a Antibody [NBP2-13861] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
Immunohistochemistry-Paraffin: Coronin-1a Antibody [NBP2-13861] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Coronin-1a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRL DRLEETVQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CORO1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Coronin-1a Protein (NBP2-13861PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Coronin-1a Antibody

  • CLIPINA
  • clipin-A
  • CORO1
  • coronin, actin binding protein, 1A
  • coronin, actin-binding protein, 1A
  • coronin-1
  • coronin-1A
  • Coronin-like protein A
  • Coronin-like protein p57
  • FLJ41407
  • HCORO1
  • MGC117380
  • p57
  • TACOCLABP
  • Tryptophan aspartate-containing coat protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00056996-R01
Species: Hu
MAB6798
Species: Hu
Applications: WB, ICC

Publications for Coronin-1a Antibody (NBP2-13861) (0)

There are no publications for Coronin-1a Antibody (NBP2-13861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coronin-1a Antibody (NBP2-13861) (0)

There are no reviews for Coronin-1a Antibody (NBP2-13861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Coronin-1a Antibody (NBP2-13861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Coronin-1a Products

Bioinformatics Tool for Coronin-1a Antibody (NBP2-13861)

Discover related pathways, diseases and genes to Coronin-1a Antibody (NBP2-13861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coronin-1a Antibody (NBP2-13861)

Discover more about diseases related to Coronin-1a Antibody (NBP2-13861).
 

Pathways for Coronin-1a Antibody (NBP2-13861)

View related products by pathway.

PTMs for Coronin-1a Antibody (NBP2-13861)

Learn more about PTMs related to Coronin-1a Antibody (NBP2-13861).
 

Research Areas for Coronin-1a Antibody (NBP2-13861)

Find related products by research area.

Blogs on Coronin-1a

There are no specific blogs for Coronin-1a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Coronin-1a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CORO1A