Coronin-1a Antibody


Western Blot: Coronin-1a Antibody [NBP2-13861] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunocytochemistry/ Immunofluorescence: Coronin-1a Antibody [NBP2-13861] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
Immunohistochemistry-Paraffin: Coronin-1a Antibody [NBP2-13861] - Staining in human lymph node and pancreas tissues using anti-CORO1A antibody. Corresponding CORO1A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Coronin-1a Antibody [NBP2-13861] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells and non-germinal center cells.
Immunohistochemistry-Paraffin: Coronin-1a Antibody [NBP2-13861] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: Coronin-1a Antibody [NBP2-13861] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Coronin-1a Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRL DRLEETVQA
Specificity of human Coronin-1a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Coronin-1a Protein (NBP2-13861PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Coronin-1a Antibody

  • clipin-A
  • CORO1
  • coronin, actin binding protein, 1A
  • coronin, actin-binding protein, 1A
  • coronin-1
  • coronin-1A
  • Coronin-like protein A
  • Coronin-like protein p57
  • FLJ41407
  • HCORO1
  • MGC117380
  • p57
  • Tryptophan aspartate-containing coat protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Ze
Applications: WB, ChIP, ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC-P
Species: Hu
Species: Hu
Applications: WB, Flow, IHC

Publications for Coronin-1a Antibody (NBP2-13861) (0)

There are no publications for Coronin-1a Antibody (NBP2-13861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coronin-1a Antibody (NBP2-13861) (0)

There are no reviews for Coronin-1a Antibody (NBP2-13861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Coronin-1a Antibody (NBP2-13861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Coronin-1a Products

Bioinformatics Tool for Coronin-1a Antibody (NBP2-13861)

Discover related pathways, diseases and genes to Coronin-1a Antibody (NBP2-13861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coronin-1a Antibody (NBP2-13861)

Discover more about diseases related to Coronin-1a Antibody (NBP2-13861).

Pathways for Coronin-1a Antibody (NBP2-13861)

View related products by pathway.

PTMs for Coronin-1a Antibody (NBP2-13861)

Learn more about PTMs related to Coronin-1a Antibody (NBP2-13861).

Research Areas for Coronin-1a Antibody (NBP2-13861)

Find related products by research area.

Blogs on Coronin-1a

There are no specific blogs for Coronin-1a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Coronin-1a Antibody and receive a gift card or discount.


Gene Symbol CORO1A