Recombinant Human Corneodesmosin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Corneodesmosin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-50 of Human CDSN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDSN

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
PBS

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Corneodesmosin Protein

  • CDSN
  • Corneodesmosin
  • D6S586E
  • differentiated keratinocyte S protein
  • HTSS
  • S protein
  • S

Background

CDSN - corneodesmosin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB944
Species: Hu
Applications: WB, IHC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-04611
Species: Hu
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83210
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for Corneodesmosin Partial Recombinant Protein (H00001041-Q01) (0)

There are no publications for Corneodesmosin Partial Recombinant Protein (H00001041-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Corneodesmosin Partial Recombinant Protein (H00001041-Q01) (0)

There are no reviews for Corneodesmosin Partial Recombinant Protein (H00001041-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Corneodesmosin Partial Recombinant Protein (H00001041-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Corneodesmosin Products

Bioinformatics Tool for Corneodesmosin Partial Recombinant Protein (H00001041-Q01)

Discover related pathways, diseases and genes to Corneodesmosin Partial Recombinant Protein (H00001041-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Corneodesmosin Partial Recombinant Protein (H00001041-Q01)

Discover more about diseases related to Corneodesmosin Partial Recombinant Protein (H00001041-Q01).
 

Pathways for Corneodesmosin Partial Recombinant Protein (H00001041-Q01)

View related products by pathway.

PTMs for Corneodesmosin Partial Recombinant Protein (H00001041-Q01)

Learn more about PTMs related to Corneodesmosin Partial Recombinant Protein (H00001041-Q01).

Blogs on Corneodesmosin

There are no specific blogs for Corneodesmosin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Corneodesmosin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDSN
Entrez