COQ3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit COQ3 Antibody - BSA Free (NBP1-88725) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
COQ3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for COQ3 Antibody - BSA Free
Background
Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes (Jonassen and Clarke, 2000 [PubMed 10777520]). This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt, RM
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Publications for COQ3 Antibody (NBP1-88725) (0)
There are no publications for COQ3 Antibody (NBP1-88725).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for COQ3 Antibody (NBP1-88725) (0)
There are no reviews for COQ3 Antibody (NBP1-88725).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for COQ3 Antibody (NBP1-88725) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional COQ3 Products
Research Areas for COQ3 Antibody (NBP1-88725)
Find related products by research area.
|
Blogs on COQ3