COQ3 Antibody

Images

 
Western Blot: COQ3 Antibody [NBP1-88725] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: COQ3 Antibody [NBP1-88725] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COQ3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COQ3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COQ3 Protein (NBP1-88725PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COQ3 Antibody

  • 3-demethylubiquinone-10 3-methyltransferase
  • bA9819.1
  • coenzyme Q3 homolog, methyltransferase (S. cerevisiae)
  • coenzyme Q3 homolog, methyltransferase (yeast)
  • DHHB methyltransferase
  • DHHBMT
  • DHHB-MT
  • DHHBMTASE
  • DHHB-MTase
  • Dihydroxyhexaprenylbenzoate methyltransferase
  • EC 2.1.1
  • EC 2.1.1.114
  • EC 2.1.1.64
  • hexaprenyldihydroxybenzoate methyltransferase, mitochondrial3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase
  • methyltransferase COQ3
  • UG0215E05

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91806
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP2-13860
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13859
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55409
Species: Hu
Applications: WB, ICC/IF
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-495
Species: Hu
Applications: WB
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00010434-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88725
Species: Hu
Applications: WB, IHC, IHC-P

Publications for COQ3 Antibody (NBP1-88725) (0)

There are no publications for COQ3 Antibody (NBP1-88725).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COQ3 Antibody (NBP1-88725) (0)

There are no reviews for COQ3 Antibody (NBP1-88725). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COQ3 Antibody (NBP1-88725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COQ3 Products

Bioinformatics Tool for COQ3 Antibody (NBP1-88725)

Discover related pathways, diseases and genes to COQ3 Antibody (NBP1-88725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COQ3 Antibody (NBP1-88725)

Discover more about diseases related to COQ3 Antibody (NBP1-88725).
 

Pathways for COQ3 Antibody (NBP1-88725)

View related products by pathway.

PTMs for COQ3 Antibody (NBP1-88725)

Learn more about PTMs related to COQ3 Antibody (NBP1-88725).
 

Research Areas for COQ3 Antibody (NBP1-88725)

Find related products by research area.

Blogs on COQ3

There are no specific blogs for COQ3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COQ3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ3