New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » COP » COP Antibodies » COP Antibody (3E10)

COP Antibody (3E10)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: COP Antibody (3E10) [H00114769-M01] - Detection limit for recombinant GST tagged COP1 is approximately 0.03ng/ml as a capture antibody.
Sandwich ELISA: COP Antibody (3E10) [H00114769-M01] - Detection limit for recombinant GST tagged COP1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

COP Antibody (3E10) Summary

Immunogen
COPl (NP_443121, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN
Specificity
COP1 - CARD only protein
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CARD16
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COP Antibody (3E10)

  • CARD only domain-containing protein 1
  • CARD only protein
  • caspase recruitment domain family, member 16
  • Caspase-1 inhibitor COP
  • COP1caspase-1 dominant-negative inhibitor pseudo-ICE
  • COPcaspase recruitment domain-containing protein 16
  • EC 3.4.22.36
  • Pseudo interleukin-1 beta converting enzyme
  • pseudo interleukin-1beta converting enzyme
  • PSEUDO-ICE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(17 Publications)
Species: Hu
Applications: BA
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
Flow Cytometry: GADD153/CHOP Antibody (9C8) [NB600-1335] - An intracellular stain was performed on SK-MEL-28 cells with GADD153/CHOP Antibody (9C8) NB600-1335 (blue) and a matched isotype control MAB004 (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (84540, Thermo Fisher).
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody (9C8) [NB600-1335] - FFPE tissue section of mouse brain using 1:100 dilution of GADD153/CHOP antibody. The signal was developed using HRP-DAB based detection method which followed counterstaining of the nuclei with hematoxylin. The antibody generated a cytoplasmic and nuclear staining of CHOP in various cell types in the tested section.
(3 Reviews)
(37 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot: MUL1 Antibody (5H6.2D5) [NBP2-31361] - WB detection of partial recombinant protein MUL1 by using MUL1 antibody (clone 5H6.2D5) at a concentration of 0.01 ug/ml.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal prostate from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). Strong cytoplasmic staining was observed in the epithelial columnar and basal cells of prostate glands.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal cardiac stomach from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). The cardiac glands showed distinct cytoplasmic staining, wherein, the parietal cells as well as the chief cells were found positive for MUL1.
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.
Species: Hu
Applications: IHC, IHC-P
ZNF645 Antibody
NBP2-21037
Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.
Species: Hu
Applications: IHC, IHC-P, WB
DET1 Antibody
NBP2-13914
Immunohistochemistry-Paraffin: DET1 Antibody [NBP2-13914] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunocytochemistry/Immunofluorescence: DET1 Antibody [NBP2-13914] - Staining of human cell line A549 shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ARF1 Antibody (1D9)
NB300-505
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of 3T3 cells compared to an isotype control (blue).
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of Hela cells compared to an isotype control (blue).
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of MCF-7 cells compared to an isotype control (blue).
(13 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
CRY1 Antibody
[Unconjugated]
AF3764
CRY1 was detected in immersion fixed MOLT‑4 human acute lymphoblastic leukemia cell line using Goat Anti-Human/Mouse CRY1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3764) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Sample(30 ug of whole cell lysate) A:293T 10% SDS PAGE, antibody diluted at 1:1000.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ILT6/CD85e/LILRA3
Antibody
NBP1-98549
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Human OVCAR-3 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/mL. Peptide Concentration: 2.0 ug/mL lysate. Quantity: 25 ug/lane.
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Kidney.
(1 Review)
Species: Hu
Applications: WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - Analysis of Hela cells, using anti-RanGAP1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - Analysis of Jurkat cells, using anti-RanGAP1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RanGAP1 antibody, and then analyzed by flow cytometry.
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
COPS8 Antibody
H00010920-B01P
Western Blot: COPS8 Antibody [H00010920-B01P] - analysis of COPS8 expression in transfected 293T cell line by COPS8 MaxPab polyclonal antibody. Lane 1: COPS8 transfected lysate (23.1 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: COPS8 Antibody [H00010920-B01P] - Analysis of purified antibody to COPS8 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: COPS8 Antibody [H00010920-B01P] - Analysis of COPS8 expression in rat brain.
Species: Hu, Rt
Applications: ICC/IF, WB
SIPA1 Antibody
NBP2-20369
Western Blot: SIPA1 Antibody [NBP2-20369] - Western Blot analysis of SIPA1 expression in transfected 293T cell line by SIPA1 polyclonal antibody. A: Non-transfected lysate. B: SIPA1 transfected lysate. 7. 5% SDS PAGE gel, diluted at 1:500.
Immunocytochemistry/Immunofluorescence: SIPA1 Antibody [NBP2-20369] - Analysis of methanol-fixed mouse ESC, using SIPA1 antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: SIPA1 Antibody [NBP2-20369] - Paraffin-embedded Cal27 xenograft. SIPA1 antibody [C3], C-term dilution: 1:500.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
COP Antibody (3E10)
H00114769-M01
COP Antibody (3E10)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for COP Antibody (H00114769-M01) (0)

There are no publications for COP Antibody (H00114769-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COP Antibody (H00114769-M01) (0)

There are no reviews for COP Antibody (H00114769-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COP Antibody (H00114769-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COP Products

Bioinformatics Tool for COP Antibody (H00114769-M01)

Discover related pathways, diseases and genes to COP Antibody (H00114769-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for COP Antibody (H00114769-M01)

Find related products by research area.

Blogs on COP

There are no specific blogs for COP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COP Antibody (3E10) and receive a gift card or discount.


Bioinformatics

Gene Symbol CARD16
Entrez
Uniprot