COP Antibody (3E10)

Images

 
Sandwich ELISA: COP Antibody (3E10) [H00114769-M01] - Detection limit for recombinant GST tagged COP1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COP Antibody (3E10) Summary

Immunogen
COPl (NP_443121, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN
Specificity
COP1 - CARD only protein
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CARD16
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COP Antibody (3E10)

  • CARD only domain-containing protein 1
  • CARD only protein
  • caspase recruitment domain family, member 16
  • Caspase-1 inhibitor COP
  • COP1caspase-1 dominant-negative inhibitor pseudo-ICE
  • COPcaspase recruitment domain-containing protein 16
  • EC 3.4.22.36
  • Pseudo interleukin-1 beta converting enzyme
  • pseudo interleukin-1beta converting enzyme
  • PSEUDO-ICE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP, KD
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13914
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-69080
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010920-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-20369
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00114769-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for COP Antibody (H00114769-M01) (0)

There are no publications for COP Antibody (H00114769-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COP Antibody (H00114769-M01) (0)

There are no reviews for COP Antibody (H00114769-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COP Antibody (H00114769-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional COP Products

Bioinformatics Tool for COP Antibody (H00114769-M01)

Discover related pathways, diseases and genes to COP Antibody (H00114769-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for COP Antibody (H00114769-M01)

Find related products by research area.

Blogs on COP

There are no specific blogs for COP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COP Antibody (3E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD16
Entrez
Uniprot