Home » Contactin-5 » Contactin-5 Proteins » Contactin-5 Recombinant Protein Antigen

Contactin-5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Contactin-5 Protein (NBP1-83243PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Contactin-5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CNTN5.

Source: E.coli

Amino Acid Sequence: IVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CNTN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83243.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Contactin-5 Recombinant Protein Antigen

  • CNTN5
  • contactin 5
  • Contactin5
  • Contactin-5
  • hNB-2
  • HNB-2s
  • MGC163491
  • NB2
  • NB-2
  • neural adhesion molecule
  • Neural recognition molecule NB-2

Background

CNTN5 is encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.; ; Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity in the cerebral cortical neurons but not in hippocampal neurons. Involved in neuronal activity in the auditory system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAM49B Antibody
NBP1-88582
Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
L1CAM Antibody
(UJ127.11) - BSA Free
NB100-2682
Flow Cytometry: L1CAM Antibody (UJ127.11) [NB100-2682] - A surface stain was performed on HeLa cells with L1CAM Antibody (UJ127.11) NB100-2682 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 2.5 ug/mL for 20 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
Western Blot: L1CAM Antibody (UJ127.11) [NB100-2682] - Total protein from human HeLa, A431 and SHSY-5Y cell lines and human Brain was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-L1CAM (NB100-2682) in blocking buffer and detected with an anti-mouse HRP secondary antibody using NovaLume chemiluminescence detection reagent (NPB2-61915).
Immunohistochemistry-Paraffin: L1CAM Antibody (UJ127.11) [NB100-2682] - Analysis of a FFPE tissue section of human brain using 1:200 dilution of L1CAM [UJ127.11] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Cytoplasmic and membrane staining as observed in the cerebral cortex
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Contactin-2/TAG1
Antibody [Unconjugate ...
AF4439
Contactin‑2/TAG1 was detected in immersion fixed frozen sections of mouse embryo (E13) using Goat Anti-Human/Mouse/Rat Contactin‑2/TAG1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4439) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to muscle cells in proximity to ribs. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse spinal cord tissue, loaded at 0.2 mg/mL. A specific band was detected for Contactin‑2/TAG1 at approximately 162 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑2/TAG1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4439) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of human cerebellum tissue, mouse brain tissue, and rat brain tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑2/TAG1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4439) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Contactin‑2/TAG1 at approximately 135 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NCAM-1/CD56
Antibody [Unconjugate
AF2408
Western blot shows lysates of human brain (cerebellum and motor cortex) tissue and mouse brain (cerebellum) tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse NCAM‑1/CD56 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2408) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for NCAM‑1/CD56 at approximately 100-150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human and mouse brain (cerebellum) tissue, loaded at 0.2 mg/mL. A specific band was detected for NCAM‑1/CD56 at approximately 143 kDa (as indicated) using 5 µg/mL for human lysates and 25 µg/mL for mouse lysates of Goat Anti-Human/Mouse NCAM‑1/CD56 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2408) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
NCAM‑1/CD56 was detected in immersion fixed BG01V human embryonic stem cells differentiated into neural progenitor cells using Goat Anti-Human/Mouse NCAM‑1/CD56 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2408) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(10 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Contactin-1
Antibody [Unconjugate
AF904
Western blot shows lysates of human brain (cortex) tissue, human brain (cerebellum) tissue, mouse brain (cerebellum) tissue, mouse brain (total) tissue, and rat brain (total) tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Contactin‑1 at approximately 135 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Contactin‑1 was detected in immersion fixed paraffin-embedded sections of human dorsal root ganglia using 15 µg/mL Goat Anti-Human/Mouse/Rat Contactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Contactin‑1 Fc Chimera (Catalog # 904-CN), immobilized onto a microplate, supports the adhesion of the C6 rat glioma cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Human Contactin‑1 Fc Chimera (2 µg/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/RatContactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904). The ND50 is typically 1-5 µg/mL.
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
(23 Publications)
Species: Hu
Applications: ELISA
Contactin-4
Antibody
AF5495
Western blot shows lysates of mouse brain (cortex) tissue. PVDF Membrane was probed with 2 µg/mL of Sheep Anti-Mouse Contactin‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5495) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Contactin‑4 at approximately 135 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Contactin‑4 was detected in perfusion fixed frozen sections of mouse brain (15 d.p.c.) using Sheep Anti-Mouse Contactin‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5495) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal processes. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu
Applications: IHC, WB
MAG/Siglec-4a
538-MG
MAG/Siglec-4a
(19 Publications)
Species: Rt
Applications: BA
Contactin-3
Antibody
AF5539
Western blot shows lysates of mouse, human, and rat brain tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5539) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Contactin‑3 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Contactin‑3 was detected in immersion fixed bEnd.3 mouse endothelioma cell line using Goat Anti-Human/Mouse/Rat Contactin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5539) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
SIRP alpha/CD172a
Antibody (OX-41) - BS ...
NB100-65530
Immunofluorescence: SIRP alpha/CD172a Antibody (OX-41) [NB100-65530] - Staining of rat lymph node cryosection with Mouse anti Rat CD172a antibody, red in A and Mouse anti Rat CD4, green in B. C is the Merged image with nuclei counter-stained blue using DAPI. Low power
Immunofluorescence: SIRP alpha/CD172a Antibody (OX-41) [NB100-65530] - Staining of rat lymph node cryosection with Mouse anti Rat CD172a antibody, red in A and Mouse anti Rat CD4, green in B. C is the Merged image with nuclei counter-stained blue using DAPI. Medium power
Immunofluorescence: SIRP alpha/CD172a Antibody (OX-41) [NB100-65530] - Staining of rat lymph node cryosection with Mouse anti Rat CD172a antibody, red in A and Mouse anti Rat CD4, green in B. C is the Merged image with nuclei counter-stained blue using DAPI. High power
(5 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Contactin-6
Antibody [Unconjugate
AF5890
Western blot shows lysates of mouse brain (cortex) tissue, mouse brain (hypothalamus) tissue, and mouse brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Mouse Contactin‑6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5890) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Contactin‑6 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Contactin‑6 was detected in perfusion fixed frozen sections of adult mouse spinal cord using Sheep Anti-Mouse Contactin‑6 Antigen Affinity-purified Poly­clonal Antibody (Catalog # AF5890) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counter­stained with hematoxylin (blue). Specific staining was localized to gray matter. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse brain (cortex) tissue and mouse brain (cerebellum) tissue, loaded at 0.2 mg/mL. A specific band was detected for Contactin‑6 at approximately 168 kDa (as indicated) using 10 µg/mL of Sheep Anti-Mouse Contactin‑6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5890) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
CHL-1/L1CAM-2
Antibody [Unconjugate
AF2147
Western blot shows lysates of mouse brain stem tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse CHL‑1/L1CAM‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2147) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for CHL‑1/L1CAM‑2 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse brain (cortex) tissue and mouse brain stem tissue, loaded at 0.2 mg/mL. A specific band was detected for CHL‑1/L1CAM‑2 at approximately 196-201 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse CHL‑1/L1CAM‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2147) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(13 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
GFAP Antibody
NB300-141
Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
Western Blot: GFAP Antibody [NB300-141] - Analysis of different tissue lysates using rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. Strong band at about 50 kDa corresponds to the major isotype of the GFAP protein. Smaller isotypes and proteolytic fragments of GFAP are also detected on the blot.
Western Blot: GFAP Antibody [NB300-141] - Analysis of Rat brain lysate. Antibody at 1:5000. Specific band running with an apparent SDS-PAGE molecular weight of ~50 kDa corresponds to rodent GFAP was observed.
(12 Reviews)
(83 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DSCAM Antibody
[Unconjugated] - Long ...
AF3666
Western blot shows 25 ng of Recombinant Human DSCAM (Catalog # 3666-DS) and Recombinant Human DSCAM‑L1 (Catalog # 3315-DL). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human DSCAM Long Isoform Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3666) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for DSCAM at approximately 250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
DSCAM was detected in immersion fixed A172 human glioblastoma cell line using 10 µg/mL Goat Anti-Human DSCAM Long Isoform Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3666) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Publications)
Species: Hu
Applications: ICC, WB
Contactin-5
Recombinant Protein A
NBP1-83243PEP
Contactin-5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Contactin-5 Protein (NBP1-83243PEP) (0)

There are no publications for Contactin-5 Protein (NBP1-83243PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Contactin-5 Protein (NBP1-83243PEP) (0)

There are no reviews for Contactin-5 Protein (NBP1-83243PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Contactin-5 Protein (NBP1-83243PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Contactin-5 Products

Bioinformatics Tool for Contactin-5 Protein (NBP1-83243PEP)

Discover related pathways, diseases and genes to Contactin-5 Protein (NBP1-83243PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Contactin-5 Protein (NBP1-83243PEP)

Discover more about diseases related to Contactin-5 Protein (NBP1-83243PEP).
 

Pathways for Contactin-5 Protein (NBP1-83243PEP)

View related products by pathway.

Research Areas for Contactin-5 Protein (NBP1-83243PEP)

Find related products by research area.

Blogs on Contactin-5

There are no specific blogs for Contactin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
GFAP Antibody
NB300-141

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Contactin-5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CNTN5