Home » Contactin-5 » Contactin-5 Proteins » Contactin-5 Recombinant Protein Antigen

Contactin-5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Contactin-5 Protein (NBP1-83243PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Contactin-5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CNTN5.

Source: E.coli

Amino Acid Sequence: IVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CNTN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83243.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Contactin-5 Recombinant Protein Antigen

  • CNTN5
  • contactin 5
  • Contactin5
  • Contactin-5
  • hNB-2
  • HNB-2s
  • MGC163491
  • NB2
  • NB-2
  • neural adhesion molecule
  • Neural recognition molecule NB-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAM49B Antibody
NBP1-88582
Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
L1CAM Antibody
(UJ127.11) - Azide Fr
NB100-2682
L1CAM Antibody (UJ127.11) - Azide Free
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
Contactin-2/TAG1
Antibody [Unconjugate ...
AF4439
Western blot shows lysates of mouse spinal cord tissue and rat embryonic cortical neuron/glial cells. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Mouse/Rat Contactin‑2/TAG1 Polyclonal Antibody (Catalog # AF4439) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Contactin‑2/TAG1 at approximately 135 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Contactin‑2/TAG1 was detected in immersion fixed frozen sections of mouse embryo (E13) using Goat Anti-Mouse/Rat Contactin‑2/TAG1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4439) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to muscle cells in proximity to ribs. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse spinal cord tissue, loaded at 0.2 mg/mL. A specific band was detected for Contactin‑2/TAG1 at approximately 162 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse/Rat Contactin‑2/TAG1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4439) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(7 Publications)
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NCAM-1/CD56
Antibody (123C3 (same ...
NBP2-15184
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - Formalin-fixed, paraffin-embedded human colon Ganglion stained with CD56 Monoclonal Antibody (123C3.D5)
Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [Alexa Fluor® 647] [NBP2-33132AF647] - A surface stain was performed on SH-SY5Y cells with NCAM-1/CD56 Antibody (123C3) NBP2-33132AF647 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes.Both antibodies were conjugated to Alexa Fluor 647. Image using the Alexa Fluor 647 form of this antibody.
Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - analysis of CD56 on human monocytes using CD56 antibody at 1 ug/10^6 cells.
(1 Review)
(4 Publications)
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Contactin-1
Antibody [Unconjugate
AF904
Western blot shows lysates of human brain (cortex) tissue, human brain (cerebellum) tissue, mouse brain (cerebellum) tissue, mouse brain (total) tissue, and rat brain (total) tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Contactin‑1 at approximately 135 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human brain tissue and mouse brain tissue, loaded at 0.2 mg/mL. A specific band was detected for Contactin‑1 at approximately 158 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Contactin‑1 was detected in immersion fixed paraffin-embedded sections of human dorsal root ganglia using 15 µg/mL Goat Anti-Human/Mouse/Rat Contactin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF904) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
Coagulation Factor
III/Tissue Factor Ant ...
AF2339
Coagulation Factor III/Tissue Factor Antibody
(3 Reviews)
(3 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Contactin-4
Antibody
AF5495
Western blot shows lysates of mouse brain (cortex) tissue. PVDF Membrane was probed with 2 µg/mL of Sheep Anti-Mouse Contactin‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5495) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Contactin‑4 at approximately 135 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Contactin‑4 was detected in perfusion fixed frozen sections of mouse brain (15 d.p.c.) using Sheep Anti-Mouse Contactin‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5495) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal processes. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu
Applications: WB, IHC
MAG/Siglec-4a
538-MG
MAG/Siglec-4a
(1 Review)
(14 Publications)
Species: Rt
Contactin-3
Antibody
AF5539
Western blot shows lysates of mouse, human, and rat brain tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5539) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Contactin‑3 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Contactin‑3 was detected in immersion fixed bEnd.3 mouse endothelioma cell line using Goat Anti-Human/Mouse/Rat Contactin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5539) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu, Rt
Applications: WB, ICC
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
CTLA-4 Antibody
[Unconjugated]
AF-386-PB
Western blot shows lysates of NS0 mouse myeloma cell line either mock transfected or transfected with human CTLA-4. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for CTLA‑4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NS0 mouse myeloma cell line co-transfected with human CTLA-4 and eGFP was stained with either (A) Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) or (B) Normal Goat IgG Control (Catalog # AB-108-C) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
CTLA‑4 was detected in immersion fixed human peripheral blood mononuclear cells treated with treated with PMA and calcium ionomycin using Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
SIRP alpha/CD172a
Antibody (602411)
MAB4546
Western blot shows lysates of human granulocytes. PVDF Membrane was probed with 2 µg/mL of Mouse Anti-Human SIRP alpha /CD172a Monoclonal Antibody (Catalog # MAB4546) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for SIRP alpha /CD172a at approximately 70 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
U937 human histiocytic lymphoma cell line was stained with Mouse Anti-Human SIRP alpha /CD172a Monoclonal Antibody (Catalog # MAB4546, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0101B).
SIRP alpha /CD172a was detected in immersion fixed THP‑1 human acute monocytic leukemia cell line using Mouse Anti-Human SIRP alpha /CD172a Monoclonal Antibody (Catalog # MAB4546) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI. Specific staining was localized to cell membranes. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Contactin-6
Antibody [Unconjugate
AF5890
Western blot shows lysates of mouse brain (cortex) tissue, mouse brain (hypothalamus) tissue, and mouse brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Mouse Contactin‑6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5890) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Contactin‑6 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Contactin‑6 was detected in perfusion fixed frozen sections of adult mouse spinal cord using Sheep Anti-Mouse Contactin‑6 Antigen Affinity-purified Poly­clonal Antibody (Catalog # AF5890) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counter­stained with hematoxylin (blue). Specific staining was localized to gray matter. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse brain (cortex) tissue and mouse brain (cerebellum) tissue, loaded at 0.2 mg/mL. A specific band was detected for Contactin‑6 at approximately 168 kDa (as indicated) using 10 µg/mL of Sheep Anti-Mouse Contactin‑6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5890) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
CHL-1/L1CAM-2
Antibody [Unconjugate
AF2147
Western blot shows lysates of mouse brain stem tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse CHL‑1/L1CAM‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2147) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for CHL‑1/L1CAM‑2 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse brain (cortex) tissue and mouse brain stem tissue, loaded at 0.2 mg/mL. A specific band was detected for CHL‑1/L1CAM‑2 at approximately 196-201 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse CHL‑1/L1CAM‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2147) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(9 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
GFAP Antibody
NB300-141
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - ICC-IF analysis of mixed neuron-glial cultures using GFAP antibody NB300-141 (red) and Vimentin antibody NB300-223 (green). The fibroblastic cells contain only Vimentin and so are green. The astrocytes contain either Vimentin and GFAP (appearing golden) or predominantly GFAP (appearing red). Blue is nuclear DNA stain.
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Rat neurons stained with Neurofilament Heavy antibody NB300-217 (red) and GFAP antibody NB300-141 (green).
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Xenografted mouse brain section : astocyte and human nuclei. Image from a confirmed customer review.
(4 Reviews)
(32 Publications)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
DSCAM Antibody
NBP2-30716
Immunocytochemistry/Immunofluorescence: DSCAM Antibody [NBP2-30716] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DSCAM Antibody [NBP2-30716] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: DSCAM Antibody [NBP2-30716] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Contactin-5
Recombinant Protein A
NBP1-83243PEP
Contactin-5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Contactin-5 Protein (NBP1-83243PEP) (0)

There are no publications for Contactin-5 Protein (NBP1-83243PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Contactin-5 Protein (NBP1-83243PEP) (0)

There are no reviews for Contactin-5 Protein (NBP1-83243PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Contactin-5 Protein (NBP1-83243PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Contactin-5 Protein (NBP1-83243PEP)

Discover related pathways, diseases and genes to Contactin-5 Protein (NBP1-83243PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Contactin-5 Protein (NBP1-83243PEP)

Discover more about diseases related to Contactin-5 Protein (NBP1-83243PEP).
 

Pathways for Contactin-5 Protein (NBP1-83243PEP)

View related products by pathway.

Blogs on Contactin-5

There are no specific blogs for Contactin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contactin-5 Recombinant Protein Antigen
NBP1-83242PEP
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - ICC-IF analysis of mixed neuron-glial cultures using GFAP antibody NB300-141 (red) and Vimentin antibody NB300-223 (green). The fibroblastic cells contain only Vimentin and so are green. The astrocytes contain either Vimentin and GFAP (appearing golden) or predominantly GFAP (appearing red). Blue is nuclear DNA stain.
GFAP Antibody
NB300-141
Western Blot: Contactin-5 Antibody [NBP1-83242] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Contactin-5 Antibody
NBP1-83242
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
NOD2 Antibody (2D9)
NB100-524

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Contactin-5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CNTN5
Entrez