Contactin-5 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CNTN5. Source: E.coli
Amino Acid Sequence: IVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYG |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
CNTN5 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This peptide is useful as a blocking peptide for NBP1-83243.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for Contactin-5 Recombinant Protein Antigen
Background
CNTN5 is encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.; ; Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity in the cerebral cortical neurons but not in hippocampal neurons. Involved in neuronal activity in the auditory system.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC, WB
Species: Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: AC
Publications for Contactin-5 Protein (NBP1-83243PEP) (0)
There are no publications for Contactin-5 Protein (NBP1-83243PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Contactin-5 Protein (NBP1-83243PEP) (0)
There are no reviews for Contactin-5 Protein (NBP1-83243PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Contactin-5 Protein (NBP1-83243PEP) (0)
Additional Contactin-5 Products
Bioinformatics Tool for Contactin-5 Protein (NBP1-83243PEP)
Discover related pathways, diseases and genes to Contactin-5 Protein (NBP1-83243PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Contactin-5 Protein (NBP1-83243PEP)
Discover more about diseases related to Contactin-5 Protein (NBP1-83243PEP).
| | Pathways for Contactin-5 Protein (NBP1-83243PEP)
View related products by pathway.
|
Research Areas for Contactin-5 Protein (NBP1-83243PEP)
Find related products by research area.
|
Blogs on Contactin-5