Contactin-5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Contactin-5 Antibody [NBP1-83243] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Contactin-5 Antibody [NBP1-83243] - Staining of human testis shows strong cytoplasmic positivity in leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Contactin-5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYG
Specificity
Specificity of human Contactin-5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in reported in scientific literature (PMID: 30747104).
Control Peptide
Publications
Read Publication using
NBP1-83243 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Contactin-5 Antibody

  • CNTN5
  • contactin 5
  • Contactin5
  • Contactin-5
  • hNB-2
  • HNB-2s
  • MGC163491
  • NB2
  • NB-2
  • neural adhesion molecule
  • Neural recognition molecule NB-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
AF4439
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
AF5495
Species: Mu
Applications: WB, IHC
AF5539
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-75525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-65530
Species: Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IF
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
AF2147
Species: Mu
Applications: WB, Simple Western, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Contactin-5 Antibody (NBP1-83243)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Contactin-5 Antibody (NBP1-83243) (0)

There are no reviews for Contactin-5 Antibody (NBP1-83243). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Contactin-5 Antibody (NBP1-83243) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Contactin-5 Products

Bioinformatics Tool for Contactin-5 Antibody (NBP1-83243)

Discover related pathways, diseases and genes to Contactin-5 Antibody (NBP1-83243). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Contactin-5 Antibody (NBP1-83243)

Discover more about diseases related to Contactin-5 Antibody (NBP1-83243).
 

Pathways for Contactin-5 Antibody (NBP1-83243)

View related products by pathway.

Blogs on Contactin-5

There are no specific blogs for Contactin-5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Contactin-5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTN5
COVID-19 update