Complement Factor MASP3/MASP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Complement Factor MASP3/MASP1 Antibody [NBP1-85460] - Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Complement Factor MASP3/MASP1 Antibody [NBP1-85460] - Staining of human stomach shows distinct positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement Factor MASP3/MASP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MASP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Complement Factor MASP3/MASP1 Protein (NBP1-85460PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement Factor MASP3/MASP1 Antibody

  • Complement Factor MASP3
  • Complement factor MASP-3
  • Complement-activating component of Ra-reactive factor
  • CRARF1
  • CRARFMAP1
  • DKFZp686I01199
  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.104
  • EC 3.4.21.42
  • FLJ26383
  • mannan-binding lectin serine peptidase 1 (C4/C2 activating component ofRa-reactive factor)
  • mannan-binding lectin serine protease 1 (C4/C2 activating component ofRa-reactive factor)
  • mannan-binding lectin serine protease 1
  • Mannose-binding lectin-associated serine protease 1
  • Mannose-binding protein-associated serine protease
  • MAp44
  • MASP
  • MASP1
  • MASP-1
  • MASP3
  • MGC126283
  • MGC126284
  • PRSS5
  • Ra-reactive factor serine protease p100
  • RaRF
  • Serine protease 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
AF3795
Species: Hu
Applications: WB, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-01625
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1807
Species: Hu
Applications: WB, IP
AF2428
Species: Hu
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-38375
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85460
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Complement Factor MASP3/MASP1 Antibody (NBP1-85460) (0)

There are no publications for Complement Factor MASP3/MASP1 Antibody (NBP1-85460).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Factor MASP3/MASP1 Antibody (NBP1-85460) (0)

There are no reviews for Complement Factor MASP3/MASP1 Antibody (NBP1-85460). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Complement Factor MASP3/MASP1 Antibody (NBP1-85460) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor MASP3/MASP1 Products

Bioinformatics Tool for Complement Factor MASP3/MASP1 Antibody (NBP1-85460)

Discover related pathways, diseases and genes to Complement Factor MASP3/MASP1 Antibody (NBP1-85460). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor MASP3/MASP1 Antibody (NBP1-85460)

Discover more about diseases related to Complement Factor MASP3/MASP1 Antibody (NBP1-85460).
 

Pathways for Complement Factor MASP3/MASP1 Antibody (NBP1-85460)

View related products by pathway.

PTMs for Complement Factor MASP3/MASP1 Antibody (NBP1-85460)

Learn more about PTMs related to Complement Factor MASP3/MASP1 Antibody (NBP1-85460).

Blogs on Complement Factor MASP3/MASP1

There are no specific blogs for Complement Factor MASP3/MASP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor MASP3/MASP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MASP1
Entrez