Complement Factor I Antibody (1B3)

Images

 
Western Blot: Complement Factor I Antibody (1B3) [H00003426-M01] - Analysis of CFI expression in transfected 293T cell line by IF monoclonal antibody (M01), clone 1B3.Lane 1: CFI transfected lysate (Predicted MW: 42.4 ...read more
Sandwich ELISA: Complement Factor I Antibody (1B3) [H00003426-M01] - Detection limit for recombinant GST tagged IF is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Complement Factor I Antibody (1B3) Summary

Immunogen
IF (NP_000195, 19 a.a. - 118 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKH
Specificity
IF (1B3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CFI
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Complement Factor I Antibody (1B3)

  • AHUS3
  • C3b Inactivator
  • C3B/C4B inactivator
  • C3BINA
  • C3b-inactivator
  • CFI
  • complement component I
  • complement control protein factor I
  • complement factor I heavy chain
  • Complement Factor I
  • EC 3.4.21
  • EC 3.4.21.45
  • FIC3b-INA
  • I factor (complement)
  • IF
  • KAF
  • Konglutinogen-activating factor
  • light chain of factor I

Background

This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uraemic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immmune deposits is another condition associated with mutation of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4779
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-83435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1936
Species: Hu
Applications: WB, IP
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF7177
Species: Hu
Applications: WB, ICC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00116085-M02
Species: Hu
Applications: WB, ELISA
H00003426-M01
Species: Hu
Applications: WB, ELISA

Publications for Complement Factor I Antibody (H00003426-M01) (0)

There are no publications for Complement Factor I Antibody (H00003426-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Factor I Antibody (H00003426-M01) (0)

There are no reviews for Complement Factor I Antibody (H00003426-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Factor I Antibody (H00003426-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor I Products

Bioinformatics Tool for Complement Factor I Antibody (H00003426-M01)

Discover related pathways, diseases and genes to Complement Factor I Antibody (H00003426-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor I Antibody (H00003426-M01)

Discover more about diseases related to Complement Factor I Antibody (H00003426-M01).
 

Pathways for Complement Factor I Antibody (H00003426-M01)

View related products by pathway.

PTMs for Complement Factor I Antibody (H00003426-M01)

Learn more about PTMs related to Complement Factor I Antibody (H00003426-M01).

Blogs on Complement Factor I

There are no specific blogs for Complement Factor I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor I Antibody (1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CFI
Entrez
OMIM
Uniprot