Recombinant Human COLQ GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human COLQ GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 356-455 of Human COLQ

Source: Wheat Germ

Amino Acid Sequence: PIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGSDFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
COLQ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COLQ GST (N-Term) Protein

  • acetylcholinesterase collagenic tail peptide
  • AChE Q subunit
  • collagenic tail of endplate acetylcholinesterase
  • collagen-like tail subunit (single strand of homotrimer) of asymmetricacetylcholinesterase
  • EADAcetylcholinesterase-associated collagen
  • FLJ55041
  • single strand of homotrimeric collagen-like tail subunit of asymmetricacetylcholinesterase

Background

COLQ - collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92686
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, ICC/IF, IHC
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-80513
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-85537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84935
Species: Hu
Applications: IHC, IHC-P
H00008292-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for COLQ Partial Recombinant Protein (H00008292-Q01) (0)

There are no publications for COLQ Partial Recombinant Protein (H00008292-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COLQ Partial Recombinant Protein (H00008292-Q01) (0)

There are no reviews for COLQ Partial Recombinant Protein (H00008292-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COLQ Partial Recombinant Protein (H00008292-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Does your company produce ColQ protein?
    • We sell both a ColQ lysate (Novus Product NBP2-04296) and a partial recombinant protein (Novus Product H00008292-Q01).

Other Available Formats

Additional COLQ Products

Bioinformatics Tool for COLQ Partial Recombinant Protein (H00008292-Q01)

Discover related pathways, diseases and genes to COLQ Partial Recombinant Protein (H00008292-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COLQ Partial Recombinant Protein (H00008292-Q01)

Discover more about diseases related to COLQ Partial Recombinant Protein (H00008292-Q01).
 

Pathways for COLQ Partial Recombinant Protein (H00008292-Q01)

View related products by pathway.

PTMs for COLQ Partial Recombinant Protein (H00008292-Q01)

Learn more about PTMs related to COLQ Partial Recombinant Protein (H00008292-Q01).

Blogs on COLQ

There are no specific blogs for COLQ, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COLQ GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COLQ