Collagen XXIII alpha 1 Antibody (2C9)

Sandwich ELISA: Collagen XXIII alpha 1 Antibody (2C9) [H00091522-M01] - Detection limit for recombinant GST tagged COL23A1 is 0.3 ng/ml as a capture antibody.

Product Discontinued

Collagen XXIII alpha 1 Antibody (2C9) Summary

• Immunogen: COL23A1 (NP_775736, 338 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KGELGLPGAPGIDGEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVE
• Specificity: COL23A1 (2C9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: COL23A1
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Collagen XXIII alpha 1 Antibody (2C9)

• COL23A1
• collagen alpha-1(XXIII) chain
• Collagen XXIII alpha 1
• collagen, type XXIII, alpha 1
• DKFZp434K0621
• procollagen, type XXIII, alpha 1

Background

COL23A1 is a member of the transmembrane collagens, a subfamily of the nonfibrillar collagens that contain a single pass hydrophobic transmembrane domain (Banyard et al., 2003 [PubMed 12644459]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL23A1