Collagen XXI Recombinant Protein Antigen

Images

 
There are currently no images for Collagen XXI Protein (NBP1-91015PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Collagen XXI Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL21A1.

Source: E.coli

Amino Acid Sequence: AKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL21A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-91015.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Collagen XXI Recombinant Protein Antigen

  • alpha 1 chain-like collagen
  • alpha 1 type XXI collagen
  • COL1AL
  • COLA1L
  • Collagen 21
  • collagen alpha-1(XXI) chain
  • collagen, type XXI, alpha 1
  • Collagen-21
  • dJ682J15.1
  • dJ708F5.1
  • DKFZp564B052
  • FLJ39125
  • FLJ44623
  • MGC26619

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7178
Species: Hu
Applications: WB, Simple Western
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
AF5286
Species: Hu
Applications: WB
AF3075
Species: Hu
Applications: WB, ICC
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
NLS1907
Species: Hu
Applications: IHC, IHC-P, ICC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
MAB7715
Species: Hu
Applications: WB, ICC
MAB1599
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-87718
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P

Publications for Collagen XXI Protein (NBP1-91015PEP) (0)

There are no publications for Collagen XXI Protein (NBP1-91015PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XXI Protein (NBP1-91015PEP) (0)

There are no reviews for Collagen XXI Protein (NBP1-91015PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Collagen XXI Protein (NBP1-91015PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Collagen XXI Protein (NBP1-91015PEP)

Discover related pathways, diseases and genes to Collagen XXI Protein (NBP1-91015PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen XXI Protein (NBP1-91015PEP)

Discover more about diseases related to Collagen XXI Protein (NBP1-91015PEP).
 

Pathways for Collagen XXI Protein (NBP1-91015PEP)

View related products by pathway.

PTMs for Collagen XXI Protein (NBP1-91015PEP)

Learn more about PTMs related to Collagen XXI Protein (NBP1-91015PEP).
 

Research Areas for Collagen XXI Protein (NBP1-91015PEP)

Find related products by research area.

Blogs on Collagen XXI

There are no specific blogs for Collagen XXI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Collagen XXI Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COL21A1