Collagen XIII alpha 1 Recombinant Protein Antigen

Images

 
There are currently no images for Collagen XIII alpha 1 Protein (NBP2-13854PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Collagen XIII alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL13A1.

Source: E. coli

Amino Acid Sequence: KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL13A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13854.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Collagen XIII alpha 1 Recombinant Protein Antigen

  • COL13A1
  • collagen alpha-1(XIII) chain
  • Collagen XIII alpha 1
  • collagen, type XIII, alpha 1
  • FLJ42485

Background

COL13A1 encodes the alpha chain of one of the nonfibrillar collagens. The function of this gene product is not known, however, it has been detected at low levels in all connective tissue-producing cells so it may serve a general function in connective tissues. Unlike most of the collagens, which are secreted into the extracellular matrix, collagen XIII contains a transmembrane domain and the protein has been localized to the plasma membrane. The transcripts for this gene undergo complex and extensive splicing involving at least eight exons. Like other collagens, collagen XIII is a trimer; it is not known whether this trimer is composed of one or more than one alpha chain isomer. A number of alternatively spliced transcript variants have been described, but the full length nature of some of them has not been determined. Transcript Variant: This variant (1) encodes isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
550-AG
Species: Rt
Applications: BA, BA
H00050515-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
AF482
Species: Mu
Applications: IHC, WB
AF7109
Species: Mu
Applications: IHC, WB
DY2209
Species: Hu
Applications: ELISA
AF2550
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-83992
Species: Hu
Applications: WB
NBP2-33863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33711
Species: Hu
Applications: IHC,  IHC-P
MAB41051
Species: Hu, Mu
Applications: WB
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-14300
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-14915
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-44751
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P
DR2A00
Species: Hu
Applications: ELISA

Publications for Collagen XIII alpha 1 Protein (NBP2-13854PEP) (0)

There are no publications for Collagen XIII alpha 1 Protein (NBP2-13854PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XIII alpha 1 Protein (NBP2-13854PEP) (0)

There are no reviews for Collagen XIII alpha 1 Protein (NBP2-13854PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Collagen XIII alpha 1 Protein (NBP2-13854PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Collagen XIII alpha 1 Products

Blogs on Collagen XIII alpha 1

There are no specific blogs for Collagen XIII alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Collagen XIII alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COL13A1