Collagen VIII alpha 1 Recombinant Protein Antigen

Images

 
There are currently no images for Collagen VIII alpha 1 Protein (NBP2-13856PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Collagen VIII alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL8A1.

Source: E.coli

Amino Acid Sequence: QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL8A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-13856.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Collagen VIII alpha 1 Recombinant Protein Antigen

  • alpha-1 polypeptide
  • chromosome 3 open reading frame 7
  • collagen, type VIII, alpha 1
  • smooth muscle cell-expressed and macrophage conditioned medium-induced proteinsmag-64

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30020
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37900
Species: Hu
Applications: IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE, Flow-CS
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-6588
Species: Hu, Mu, Rt, Bv, Fe, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-101
Species: Hu, Mu, Bv, Eq
Applications: WB, Flow, ICC/IF, IP
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-38694
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NBP2-46264
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85747
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP

Publications for Collagen VIII alpha 1 Protein (NBP2-13856PEP) (0)

There are no publications for Collagen VIII alpha 1 Protein (NBP2-13856PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen VIII alpha 1 Protein (NBP2-13856PEP) (0)

There are no reviews for Collagen VIII alpha 1 Protein (NBP2-13856PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Collagen VIII alpha 1 Protein (NBP2-13856PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Collagen VIII alpha 1 Protein (NBP2-13856PEP)

Discover related pathways, diseases and genes to Collagen VIII alpha 1 Protein (NBP2-13856PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen VIII alpha 1 Protein (NBP2-13856PEP)

Discover more about diseases related to Collagen VIII alpha 1 Protein (NBP2-13856PEP).
 

Pathways for Collagen VIII alpha 1 Protein (NBP2-13856PEP)

View related products by pathway.

PTMs for Collagen VIII alpha 1 Protein (NBP2-13856PEP)

Learn more about PTMs related to Collagen VIII alpha 1 Protein (NBP2-13856PEP).

Blogs on Collagen VIII alpha 1

There are no specific blogs for Collagen VIII alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CENPF Antibody
NB500-101
LOX Antibody
NB100-2527

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Collagen VIII alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COL8A1