COL8A2 Antibody

Images

 
Immunohistochemistry-Paraffin: COL8A2 Antibody [NBP2-13857] Staining of human placenta shows positivity in a subset of lymphoid cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COL8A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GYAPVKYIQPMQKGPVGPPFREGKGQYLEMPLPLLPMDLKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL8A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COL8A2 Protein (NBP2-13857PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COL8A2 Antibody

  • alpha-2 polypeptide
  • collagen, type VIII, alpha 2
  • dJ665N4.1 (collagen type VIII alpha 2)
  • FECD
  • FLJ00201
  • MGC116970
  • PPCD
  • PPCD2MGC116972

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-88514
Species: Hu
Applications: IHC, IHC-P
H00030813-R02
Species: Hu
NBP2-13856
Species: Hu
Applications: IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
MAB4608
Species: Hu, Mu, Rt
Applications: WB
NBP2-57206
Species: Hu
Applications: ICC/IF
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF650
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-05118
Species: Hu, Po, Bv, Ca, Kg, Rb, Sh, Ch(-), Gp(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85836
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-13857
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for COL8A2 Antibody (NBP2-13857) (0)

There are no publications for COL8A2 Antibody (NBP2-13857).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL8A2 Antibody (NBP2-13857) (0)

There are no reviews for COL8A2 Antibody (NBP2-13857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COL8A2 Antibody (NBP2-13857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COL8A2 Products

Bioinformatics Tool for COL8A2 Antibody (NBP2-13857)

Discover related pathways, diseases and genes to COL8A2 Antibody (NBP2-13857). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL8A2 Antibody (NBP2-13857)

Discover more about diseases related to COL8A2 Antibody (NBP2-13857).
 

Pathways for COL8A2 Antibody (NBP2-13857)

View related products by pathway.

PTMs for COL8A2 Antibody (NBP2-13857)

Learn more about PTMs related to COL8A2 Antibody (NBP2-13857).

Blogs on COL8A2

There are no specific blogs for COL8A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL8A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL8A2