COL4A3BP Antibody

Product Discontinued

COL4A3BP Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL4A3BP
• Purity: Affinity purified

Applications/Dilutions

• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for COL4A3BP Antibody

• Ceramide transfer protein
• CERTFLJ20597
• CERTL
• collagen type IV alpha-3-binding protein
• collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
• Goodpasture antigen-binding protein
• GPBPSTARD11ceramide transporter
• hCERT
• lipid-transfer protein CERTL
• StARD11
• StAR-related lipid transfer (START) domain containing 11
• StAR-related lipid transfer protein 11
• START domain containing 11
• START domain-containing protein 11

Background

COL4A3BP encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL4A3BP