COL4A3BP Antibody


Western Blot: COL4A3BP Antibody [NBP2-59018] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: COL4A3BP Antibody [NBP2-59018] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

COL4A3BP Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLH
Specificity of human COL4A3BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COL4A3BP Recombinant Protein Antigen (NBP2-59018PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for COL4A3BP Antibody

  • Ceramide transfer protein
  • CERTFLJ20597
  • collagen type IV alpha-3-binding protein
  • collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
  • Goodpasture antigen-binding protein
  • GPBPSTARD11ceramide transporter
  • hCERT
  • lipid-transfer protein CERTL
  • StARD11
  • StAR-related lipid transfer (START) domain containing 11
  • StAR-related lipid transfer protein 11
  • START domain containing 11
  • START domain-containing protein 11


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for COL4A3BP Antibody (NBP2-59018) (0)

There are no publications for COL4A3BP Antibody (NBP2-59018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL4A3BP Antibody (NBP2-59018) (0)

There are no reviews for COL4A3BP Antibody (NBP2-59018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COL4A3BP Antibody (NBP2-59018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for COL4A3BP Antibody (NBP2-59018)

Discover related pathways, diseases and genes to COL4A3BP Antibody (NBP2-59018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL4A3BP Antibody (NBP2-59018)

Discover more about diseases related to COL4A3BP Antibody (NBP2-59018).

Pathways for COL4A3BP Antibody (NBP2-59018)

View related products by pathway.

PTMs for COL4A3BP Antibody (NBP2-59018)

Learn more about PTMs related to COL4A3BP Antibody (NBP2-59018).

Research Areas for COL4A3BP Antibody (NBP2-59018)

Find related products by research area.

Blogs on COL4A3BP

There are no specific blogs for COL4A3BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COL4A3BP Antibody and receive a gift card or discount.


Gene Symbol COL4A3BP