CoCoA Antibody

Images

 
Western Blot: CoCoA Antibody [NBP1-88215] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: CoCoA Antibody [NBP1-88215] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: CoCoA Antibody [NBP1-88215] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CoCoA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAEDEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALCOCO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CoCoA Protein (NBP1-88215PEP)
Publications
Read Publication using NBP1-88215.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CoCoA Antibody

  • calcium binding and coiled-coil domain 1
  • calphoglin
  • Cocoa
  • Coiled-coil coactivator protein
  • coiled-coil leucine zipper coactivator 1
  • inorganic pyrophosphatase activator
  • KIAA1536calcium-binding and coiled-coil domain-containing protein 1
  • Sarcoma antigen NY-SAR-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
H00085329-T01
Species: Hu
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-98474
Species: Hu
Applications: WB
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
NB200-342
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-88215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CoCoA Antibody (NBP1-88215)(1)

Reviews for CoCoA Antibody (NBP1-88215) (0)

There are no reviews for CoCoA Antibody (NBP1-88215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CoCoA Antibody (NBP1-88215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CoCoA Products

Bioinformatics Tool for CoCoA Antibody (NBP1-88215)

Discover related pathways, diseases and genes to CoCoA Antibody (NBP1-88215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CoCoA Antibody (NBP1-88215)

Discover more about diseases related to CoCoA Antibody (NBP1-88215).
 

Pathways for CoCoA Antibody (NBP1-88215)

View related products by pathway.

PTMs for CoCoA Antibody (NBP1-88215)

Learn more about PTMs related to CoCoA Antibody (NBP1-88215).

Blogs on CoCoA

There are no specific blogs for CoCoA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CoCoA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCOCO1