CoCoA Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CoCoA Antibody [NBP1-88215] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: CoCoA Antibody [NBP1-88215] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.

Western Blot: Rabbit Polyclonal CoCoA Antibody [NBP1-88215] - Expression of CALCOCO1 in VA-13 cells (mouse ADH1-transfected HepG2 cells): control, alcohol-treated, treated with CALCOCO1 siRNAs, and CALCOCO1 siRNAs and alcohol. Beta-actin is a loading control. Image from a verified customer review.

Analysis in control (vector only transfected HEK293T lysate) and CALCOCO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CoCoA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CoCoA Antibody - BSA Free (NBP1-88215) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CoCoA Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EAEDEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALCOCO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CoCoA Protein (NBP1-88215PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CoCoA Antibody - BSA Free

• calcium binding and coiled-coil domain 1
• calphoglin
• Cocoa
• Coiled-coil coactivator protein
• coiled-coil leucine zipper coactivator 1
• inorganic pyrophosphatase activator
• KIAA1536calcium-binding and coiled-coil domain-containing protein 1
• Sarcoma antigen NY-SAR-3

Background

HPS3 is involved in early stages of melanosome biogenesis and maturation. Defects in HPS3 are the cause of the cocoa (coa) mutant, and of Hermansky-Pudlak syndrome type 3 (HPS3). HPS3 is an autosomal recessive disorder, characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CoCoA Antibody (NBP1-88215)(1)

Publication using NBP1-88215

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Review for CoCoA Antibody (NBP1-88215) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Armen Petrosyan WB Human 11/06/2024

Summary

• Application: Western Blot
• Sample Tested: HepG2 hepatoma cells
• Species: Human
• Lot: R36046

Bioinformatics

• Gene Symbol: CALCOCO1