COBRA1 Recombinant Protein Antigen

Images

 
There are currently no images for COBRA1 Protein (NBP1-82924PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

COBRA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COBRA1.

Source: E.coli

Amino Acid Sequence: KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLED

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COBRA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82924.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for COBRA1 Recombinant Protein Antigen

  • cofactor of BRCA1DKFZp586B0519
  • KIAA1182negative elongation factor B
  • NELFB
  • NELF-Bnegative elongation factor protein B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92175
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
H00051497-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-37394
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00388112-B01P
Species: Hu
Applications: WB, ELISA

Publications for COBRA1 Protein (NBP1-82924PEP) (0)

There are no publications for COBRA1 Protein (NBP1-82924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COBRA1 Protein (NBP1-82924PEP) (0)

There are no reviews for COBRA1 Protein (NBP1-82924PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for COBRA1 Protein (NBP1-82924PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for COBRA1 Protein (NBP1-82924PEP)

Discover related pathways, diseases and genes to COBRA1 Protein (NBP1-82924PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COBRA1 Protein (NBP1-82924PEP)

Discover more about diseases related to COBRA1 Protein (NBP1-82924PEP).
 

Pathways for COBRA1 Protein (NBP1-82924PEP)

View related products by pathway.

PTMs for COBRA1 Protein (NBP1-82924PEP)

Learn more about PTMs related to COBRA1 Protein (NBP1-82924PEP).

Blogs on COBRA1.

COBRA1: A Key Player in Transcriptional Pausing
Co-factor of BRCA1, also known as COBRA1, was first identified as a protein that binds to the tumour suppressor protein encoded by the breast cancer susceptibility gene BRCA1 (1). It was subsequently found to be identical to subunit B of the Negative...  Read full blog post.

Customers Who Bought This Also Bought

COBRA1 Antibody
NBP1-82924

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COBRA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COBRA1