Coatomer Subunit Delta Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP2-55235] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Coatomer Subunit Delta Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPN
Specificity
Specificity of human Coatomer Subunit Delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARCN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Coatomer Subunit Delta Recombinant Protein Antigen (NBP2-55235PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Coatomer Subunit Delta Antibody

  • archain 1
  • archain vesicle transport protein 1
  • Archain
  • coatomer delta subunit
  • coatomer protein complex, subunit delta
  • coatomer protein delta-COP
  • coatomer subunit delta
  • COPD
  • Delta-coat protein
  • delta-COP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22544
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-856
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-55178
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP2-38512
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-85457
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Coatomer Subunit Delta Antibody (NBP2-55235) (0)

There are no publications for Coatomer Subunit Delta Antibody (NBP2-55235).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coatomer Subunit Delta Antibody (NBP2-55235) (0)

There are no reviews for Coatomer Subunit Delta Antibody (NBP2-55235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Coatomer Subunit Delta Antibody (NBP2-55235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Coatomer Subunit Delta Products

Bioinformatics Tool for Coatomer Subunit Delta Antibody (NBP2-55235)

Discover related pathways, diseases and genes to Coatomer Subunit Delta Antibody (NBP2-55235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coatomer Subunit Delta Antibody (NBP2-55235)

Discover more about diseases related to Coatomer Subunit Delta Antibody (NBP2-55235).
 

Pathways for Coatomer Subunit Delta Antibody (NBP2-55235)

View related products by pathway.

Blogs on Coatomer Subunit Delta

There are no specific blogs for Coatomer Subunit Delta, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Coatomer Subunit Delta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARCN1